DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTL10 and Actl10

DIOPT Version :9

Sequence 1:NP_001019846.1 Gene:ACTL10 / 170487 HGNCID:16127 Length:245 Species:Homo sapiens
Sequence 2:NP_001165111.1 Gene:Actl10 / 70362 MGIID:1917612 Length:346 Species:Mus musculus


Alignment Length:245 Identity:191/245 - (77%)
Similarity:208/245 - (84%) Gaps:0/245 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MASTALLALCSTGAFSGLAVEAGAGVCHATPIYAGHSWHQATFRLNVAGSTLSRYLRDLLVAANP 65
            ||:||||||||.|||||||||||||||||||||||||||:|||||||||||||||.|||||||.|
Mouse   102 MANTALLALCSIGAFSGLAVEAGAGVCHATPIYAGHSWHKATFRLNVAGSTLSRYFRDLLVAACP 166

Human    66 DLLQQALPRKAITHLKKRSCYVSLDFEGDLRDPARHHPASFSVGNGCCVCLSSERFRCPEPIFQP 130
            ||..|.|.||.:|.||||.|||||||:||:.|||||..|.|.:||||.|.|.|||||||||||||
Mouse   167 DLQLQGLSRKTVTQLKKRCCYVSLDFQGDICDPARHQRACFCLGNGCYVRLGSERFRCPEPIFQP 231

Human   131 GLLGQAEQGLPALAFRALQKMPKTLRTRLADTVVLAGGSTLFPGFAERLDKELEAQCRRHGYAAL 195
            .|||..|.|||.|||:||||:|.|||||||:||||||||||||||.||::.|||||||||||.||
Mouse   232 SLLGHPEPGLPTLAFQALQKIPTTLRTRLANTVVLAGGSTLFPGFVERMNLELEAQCRRHGYPAL 296

Human   196 RPHLVAKHGRGMAVWTGGSMVASLHSFQRRWITRAMYQECGSRLLYDVFN 245
            :|.|||..||..||||||||:|||:|||.||:|||||||.|..|:.|||:
Mouse   297 QPCLVAHPGRDTAVWTGGSMMASLNSFQCRWMTRAMYQEHGPLLVRDVFD 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTL10NP_001019846.1 NBD_sugar-kinase_HSP70_actin <2..237 CDD:327376 185/234 (79%)
Actl10NP_001165111.1 NBD_sugar-kinase_HSP70_actin 37..341 CDD:302596 187/238 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83973377
Domainoid 1 1.000 252 1.000 Domainoid score I19712
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128516
Inparanoid 1 1.050 382 1.000 Inparanoid score I13944
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG36681
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0016116
OrthoInspector 1 1.000 - - oto126253
orthoMCL 1 0.900 - - OOG6_135448
Panther 1 1.100 - - LDO PTHR11937
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R12076
SonicParanoid 1 1.000 - - X13022
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1717.440

Return to query results.
Submit another query.