DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTL10 and act-4

DIOPT Version :9

Sequence 1:NP_001019846.1 Gene:ACTL10 / 170487 HGNCID:16127 Length:245 Species:Homo sapiens
Sequence 2:NP_508841.1 Gene:act-4 / 180767 WormBaseID:WBGene00000066 Length:376 Species:Caenorhabditis elegans


Alignment Length:243 Identity:81/243 - (33%)
Similarity:140/243 - (57%) Gaps:7/243 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MASTALLALCSTGAFSGLAVEAGAGVCHATPIYAGHSWHQATFRLNVAGSTLSRYLRDLLVAANP 65
            :|..|:|:|.::|..:|:.:::|.||.|..|||.|::...|..||::||..|:.||..:|.....
 Worm   135 VAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGY 199

Human    66 DLLQQALPRKAITHLKKRSCYVSLDFEGDLRDPARHH--PASFSVGNGCCVCLSSERFRCPEPIF 128
            .....| .|:.:..:|::.|||:||||.::...|...  ..|:.:.:|..:.:.:|||||||.:|
 Worm   200 SFTTTA-EREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALF 263

Human   129 QPGLLGQAEQGLPALAFRALQKMPKTLRTRLADTVVLAGGSTLFPGFAERLDKELEAQCRRHGYA 193
            ||..||....|:...::.::.|....:|..|....||:||:|::||.|:|:.||:.|...    :
 Worm   264 QPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP----S 324

Human   194 ALRPHLVAKHGRGMAVWTGGSMVASLHSFQRRWITRAMYQECGSRLLY 241
            .::..::|...|..:||.|||::|||.:||:.||::..|.|.|..:::
 Worm   325 TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTL10NP_001019846.1 NBD_sugar-kinase_HSP70_actin <2..237 CDD:327376 80/236 (34%)
act-4NP_508841.1 PTZ00281 1..376 CDD:173506 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.