DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARX and yox1

DIOPT Version :9

Sequence 1:NP_620689.1 Gene:ARX / 170302 HGNCID:18060 Length:562 Species:Homo sapiens
Sequence 2:NP_595674.1 Gene:yox1 / 2540309 PomBaseID:SPBC21B10.13c Length:201 Species:Schizosaccharomyces pombe


Alignment Length:84 Identity:29/84 - (34%)
Similarity:46/84 - (54%) Gaps:4/84 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   304 GKDGEDSVCLSAGSDSEEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRL--D 366
            |..|:|.:..:...:.|:....:|:||.|||.....|  ||:.|.||..|.:..|:||:.:|  .
pombe    11 GNTGKDLISNNEAKNHEDEETHQKKRRRRTTDAEATL--LEQYFLKTPKPSLIERQELSKKLKSS 73

Human   367 LTEARVQVWFQNRRAKWRK 385
            :|...:|:||||:|...|:
pombe    74 MTPRELQIWFQNKRQSLRR 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARXNP_620689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..81
GCG-encoded polyalanine repeat 102..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..255
Homeobox 332..385 CDD:395001 21/54 (39%)
OAR 526..544 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 530..543
yox1NP_595674.1 COG5576 1..141 CDD:227863 29/84 (35%)
homeodomain 34..94 CDD:238039 25/61 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4015
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5874
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.