| Sequence 1: | NP_032550.2 | Gene: | Lum / 17022 | MGIID: | 109347 | Length: | 338 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
| Alignment Length: | 238 | Identity: | 77/238 - (32%) |
|---|---|---|---|
| Similarity: | 116/238 - (48%) | Gaps: | 41/238 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 68 IKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLE---------NSKIKG-----KVFSKLKQL 118
Mouse 119 KK------LHINY-NNLTESVGPLPKS----LQDLQLTNNKISKLG--SFDGLVNLTFIYLQHNQ 170
Mouse 171 LKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGL---PTSLLTLYLDNNKISNIPDEYFKRFTGLQ 232
Mouse 233 YLRLSHNELADSGV-----PG-NSFNISSLLELDLSYNKLKSI 269 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lum | NP_032550.2 | LRRNT | 37..71 | CDD:214470 | 1/2 (50%) |
| LRR_RI | <66..267 | CDD:238064 | 74/234 (32%) | ||
| LRR_8 | 66..128 | CDD:290566 | 22/80 (28%) | ||
| LRR 1 | 67..88 | 10/19 (53%) | |||
| leucine-rich repeat | 68..91 | CDD:275380 | 10/22 (45%) | ||
| LRR 2 | 91..114 | 7/36 (19%) | |||
| leucine-rich repeat | 92..117 | CDD:275380 | 9/38 (24%) | ||
| LRR_8 | 116..171 | CDD:290566 | 21/67 (31%) | ||
| LRR 3 | 117..137 | 6/26 (23%) | |||
| leucine-rich repeat | 118..138 | CDD:275380 | 6/26 (23%) | ||
| LRR 4 | 138..159 | 11/26 (42%) | |||
| leucine-rich repeat | 139..160 | CDD:275380 | 11/22 (50%) | ||
| LRR_8 | 160..217 | CDD:290566 | 20/59 (34%) | ||
| LRR 5 | 160..181 | 4/20 (20%) | |||
| leucine-rich repeat | 161..185 | CDD:275380 | 6/23 (26%) | ||
| LRR 6 | 185..205 | 9/22 (41%) | |||
| leucine-rich repeat | 186..206 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 205..266 | CDD:290566 | 22/66 (33%) | ||
| LRR 7 | 206..227 | 7/20 (35%) | |||
| leucine-rich repeat | 207..230 | CDD:275380 | 7/22 (32%) | ||
| LRR 8 | 230..250 | 7/25 (28%) | |||
| leucine-rich repeat | 231..255 | CDD:275380 | 9/29 (31%) | ||
| LRR 9 | 255..276 | 8/15 (53%) | |||
| leucine-rich repeat | 276..305 | CDD:275380 | |||
| LRR 10 | 277..296 | ||||
| LRR 11 | 305..326 | ||||
| leucine-rich repeat | 306..329 | CDD:275380 | |||
| CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
| LRR_8 | 64..123 | CDD:290566 | |||
| leucine-rich repeat | 65..88 | CDD:275380 | |||
| leucine-rich repeat | 89..112 | CDD:275380 | |||
| leucine-rich repeat | 113..136 | CDD:275380 | |||
| LRR_RI | 115..384 | CDD:238064 | 70/227 (31%) | ||
| LRR_8 | 135..195 | CDD:290566 | 15/33 (45%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | |||
| leucine-rich repeat | 161..184 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 184..243 | CDD:290566 | 13/58 (22%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 3/22 (14%) | ||
| LRR_8 | 232..289 | CDD:290566 | 18/56 (32%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 11/22 (50%) | ||
| LRR_8 | 280..339 | CDD:290566 | 20/59 (34%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 6/23 (26%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 9/22 (41%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45712 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||