DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLIS3 and iec1

DIOPT Version :9

Sequence 1:NP_001035878.1 Gene:GLIS3 / 169792 HGNCID:28510 Length:930 Species:Homo sapiens
Sequence 2:NP_594663.1 Gene:iec1 / 2542854 PomBaseID:SPAC144.02 Length:249 Species:Schizosaccharomyces pombe


Alignment Length:212 Identity:53/212 - (25%)
Similarity:80/212 - (37%) Gaps:73/212 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   481 ALPQATLDDDGEMDGIGGKHCCRWIDCSALYDQQEELVRHIEK----------------VHIDQR 529
            ::|.:.:|.:.|.:.|     |.|..|.......:.||.||..                .||..|
pombe    10 SVPGSPIDLEPESETI-----CHWQSCEQDLLTLDNLVHHIHNGTTSNLRLISNINSILDHIGNR 69

Human   530 KGEDFTCFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCEKAFSRLENLKIHLRSHTGE 594
            :.: :||.|..|||:.....:|:.|:                              .||||||||
pombe    70 RPK-YTCEWDDCPRKGMVQTSRFALV------------------------------AHLRSHTGE 103

Human   595 KPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSKEQ--- 656
            ||::|..|.|.::|:.|...|||.||..:..         |.|.:||..     |||....|   
pombe   104 KPFICSVPECDRSFTRSDALAKHMRTVHEAD---------TLRPSDPIP-----KAHPMHPQNVA 154

Human   657 ----QARKKLRSSTELH 669
                |:.::.|:..::|
pombe   155 NAMVQSAREARAQQQMH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLIS3NP_001035878.1 zf-H2C2_2 554..580 CDD:290200 1/25 (4%)
C2H2 Zn finger 569..591 CDD:275368 3/21 (14%)
zf-H2C2_2 583..610 CDD:290200 14/26 (54%)
C2H2 Zn finger 599..621 CDD:275368 9/21 (43%)
C2H2 Zn finger 629..651 CDD:275368 5/21 (24%)
iec1NP_594663.1 COG5048 1..>249 CDD:227381 53/212 (25%)
zf-H2C2_2 92..119 CDD:290200 15/56 (27%)
C2H2 Zn finger 108..129 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R588
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.