Sequence 1: | NP_001035878.1 | Gene: | GLIS3 / 169792 | HGNCID: | 28510 | Length: | 930 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_594663.1 | Gene: | iec1 / 2542854 | PomBaseID: | SPAC144.02 | Length: | 249 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 212 | Identity: | 53/212 - (25%) |
---|---|---|---|
Similarity: | 80/212 - (37%) | Gaps: | 73/212 - (34%) |
- Green bases have known domain annotations that are detailed below.
Human 481 ALPQATLDDDGEMDGIGGKHCCRWIDCSALYDQQEELVRHIEK----------------VHIDQR 529
Human 530 KGEDFTCFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCEKAFSRLENLKIHLRSHTGE 594
Human 595 KPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSKEQ--- 656
Human 657 ----QARKKLRSSTELH 669 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GLIS3 | NP_001035878.1 | zf-H2C2_2 | 554..580 | CDD:290200 | 1/25 (4%) |
C2H2 Zn finger | 569..591 | CDD:275368 | 3/21 (14%) | ||
zf-H2C2_2 | 583..610 | CDD:290200 | 14/26 (54%) | ||
C2H2 Zn finger | 599..621 | CDD:275368 | 9/21 (43%) | ||
C2H2 Zn finger | 629..651 | CDD:275368 | 5/21 (24%) | ||
iec1 | NP_594663.1 | COG5048 | 1..>249 | CDD:227381 | 53/212 (25%) |
zf-H2C2_2 | 92..119 | CDD:290200 | 15/56 (27%) | ||
C2H2 Zn finger | 108..129 | CDD:275368 | 8/20 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R588 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |