DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zbtb7a and CG31365

DIOPT Version :9

Sequence 1:XP_006513342.3 Gene:Zbtb7a / 16969 MGIID:1335091 Length:725 Species:Mus musculus
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:420 Identity:98/420 - (23%)
Similarity:133/420 - (31%) Gaps:149/420 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse   342 DDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPADRPPAGDGDEGDSTPGLWPERDEDAPPG-- 404
            ||..:...|.:.....|:..|:   |:.|.....|.|..:.||.|    |...|:..|||.|.  
  Fly   192 DDLRNEVSEDIRKEQLAMLLGE---LEVYLTEKKAGRWESLDGSE----PETKPQVKEDASPSRS 249

Mouse   405 ---GLFPPPTAPPATTQNGHYGRAGAGTGEEE------------------AAALSEAAPEPGDSP 448
               .|  |...|.....|.....|.....|||                  ...|.|..|      
  Fly   250 KTKAL--PKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVP------ 306

Mouse   449 GFLSGAAEGED--------GDAADVDGLAASTLLQQMMSSVGRAGDSDEESRTDDKGVMDYYLK- 504
                 |..|||        .|....|.  ....:....||..:..||..|. ..|.|:..|.:| 
  Fly   307 -----AESGEDFREINMVGSDVVHTDN--GEIYIINSASSEDQNQDSTPEF-DQDNGITSYNIKE 363

Mouse   505 ----YFSGA--------------------------HEGDVYPAWSQKGE------KKIRA----- 528
                .|||.                          ||..:.....|...      |:.|:     
  Fly   364 DGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVF 428

Mouse   529 ------------------KAFQ---------------------------------KCPICEKVIQ 542
                              |:||                                 |||.|...:.
  Fly   429 KQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLS 493

Mouse   543 GAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHM 607
            .|..|.||:..|||.||::|:.|::.|::::.||.||..|||.|.:.|.||.:.||...:|:.|:
  Fly   494 CASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHI 558

Mouse   608 -RVHTG-LRPYQCDSCCKTFVRSDHLHRHL 635
             |||.| .|.::|..|.::|.....|.|||
  Fly   559 GRVHMGNSRTHKCHLCHRSFNHVSGLSRHL 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zbtb7aXP_006513342.3 BTB_POZ_ZBTB7A 165..284 CDD:349635
C2H2 Zn finger 534..554 CDD:275368 7/19 (37%)
zf-H2C2_2 549..571 CDD:404364 10/21 (48%)
C2H2 Zn finger 562..582 CDD:275368 7/19 (37%)
zf-H2C2_2 575..599 CDD:404364 12/23 (52%)
C2H2 Zn finger 590..610 CDD:275368 8/20 (40%)
zf-H2C2_2 602..627 CDD:404364 10/26 (38%)
C2H2 Zn finger 618..636 CDD:275368 7/18 (39%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 15/58 (26%)
RRF <161..222 CDD:294170 7/32 (22%)
zf-C2H2_8 454..530 CDD:292531 18/75 (24%)
C2H2 Zn finger 485..505 CDD:275368 7/19 (37%)
zf-H2C2_2 497..522 CDD:290200 11/24 (46%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 12/23 (52%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 571..591 CDD:275368 7/18 (39%)
C2H2 Zn finger 598..617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.