DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lpl and CG6295

DIOPT Version :9

Sequence 1:NP_032535.2 Gene:Lpl / 16956 MGIID:96820 Length:474 Species:Mus musculus
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:295 Identity:92/295 - (31%)
Similarity:131/295 - (44%) Gaps:53/295 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    57 IPGLADSVSNCHFNHSSKTFVVIHGWTVT-------GMYESWVPKLVAALYKREPDSNVIVVDWL 114
            |...:.|:|..|||.:..|...||||:.:       |:.::|.         ...|.|:|.|||.
  Fly    80 IKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWF---------THGDMNMIAVDWG 135

Mouse   115 YRAQQHYPVSAGYTKLVGNDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGVAG-SLTNKKVNR 178
            ......|..|......||..||..||:|.......|||..::|:|||||.:|.|| ::.|.:::.
  Fly   136 RARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHT 200

Mouse   179 ITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGC 243
            |.|||||.|.|.|.....|||..||.:|:.:.|     .|.::|..||:|....|||||..||||
  Fly   201 IIGLDPALPLFSYDSPNKRLSSTDAYYVESIQT-----NGGTLGFLKPIGKGAFYPNGGKSQPGC 260

Mouse   244 NIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGLCLSCRKN 308
            .               ||....|:|.||:..:.:|:  .||.....||..   :|:.:...|..:
  Fly   261 G---------------VDLTGSCAHSRSVIYYAESV--TENNFPTMRCGD---YEEAVAKECGSS 305

Mouse   309 RCNNLGYEINKVRAKRSSKM-----YLKTRSQMPY 338
                  |...::.|..::.|     |:..||..||
  Fly   306 ------YSSVRMGATTNAYMVAGDYYVPVRSDAPY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LplNP_032535.2 Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 32..53
lipo_lipase 33..472 CDD:132274 92/295 (31%)
Pancreat_lipase_like 37..334 CDD:238363 88/289 (30%)
Essential for determining substrate specificity. /evidence=ECO:0000250|UniProtKB:P06858 243..266 3/22 (14%)
PLAT_LPL 341..465 CDD:238856
Important for interaction with lipoprotein particles. /evidence=ECO:0000250|UniProtKB:P06858 417..421
Important for heparin binding. /evidence=ECO:0000250|UniProtKB:P06858 430..434
Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 443..467
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 88/289 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.