DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNV2 and Shawl

DIOPT Version :9

Sequence 1:NP_598004.1 Gene:KCNV2 / 169522 HGNCID:19698 Length:545 Species:Homo sapiens
Sequence 2:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster


Alignment Length:545 Identity:136/545 - (24%)
Similarity:225/545 - (41%) Gaps:144/545 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   101 VNVGGHSYQLDYCELAGFPKTRLGRLATSTSRSRQLSLCDDYEEQTDEYFFDRDPAVFQLVYNFY 165
            :||.|..|:.....|...|.|||.||..:.:         :|:...:||||||.|.||..:.|:|
  Fly     9 LNVSGIRYETYKATLKKIPATRLSRLTEALA---------NYDPVLNEYFFDRHPGVFTQILNYY 64

Human   166 LSGVLLVLDGLCPRRFLEELGYWGVRLKYTPRCCRICFEERRD-----ELSERLKIQHELRAQAQ 225
            .:|.|.....:|...|.|||.:||:.......||...:...||     .:.::|.|::|...:.|
  Fly    65 RTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQNTLAILDKLDIENEKPTEEQ 129

Human   226 VEEA---EELFR--DMRFYGPQRRRLWNLMEKPFSSVAAKAIGVASSTFVLVSVVALALNT---- 281
            :...   ||...  ::..:...:.::|.:.::|.||..||.:...|..|:.|||::..|.|    
  Fly   130 IARLFGFEEALSNGELNCWQRIKPKIWAMFDEPSSSTGAKIVAGMSVFFIFVSVISFCLKTHPGF 194

Human   282 -------------------------------VEEMQQHS---GQGEGGPDLR------------- 299
                                           ..:..|||   ..|..||..|             
  Fly   195 RVDLPSGAHDAHGPGAGGPPHGHDPMGEPPQTHQYHQHSITPPSGSIGPTFRVTNYTSYSSGNFT 259

Human   300 ----------------------------------PILEH---------------------VEMLC 309
                                              .||.|                     ||::|
  Fly   260 ASGQATPIATIKGGQRQRLKRNINGSILNEFIEEKILGHNGRRKHGWIETYGQPHEAFFYVELVC 324

Human   310 MGFFTLEYLLRLASTPDLRRFARSALNLVDLVAILPLYLQLLLECFTGEGHQRGQTVGSVGKVGQ 374
            ..:|.:|.::||..:|:|.:|.:|.:|::|..|.|..|..::         ||      :|:...
  Fly   325 NVWFFIEVIIRLIVSPNLWQFIKSPVNIIDFTATLSFYTDVM---------QR------MGEYTG 374

Human   375 VLRVMRLMRIFRILKLARHSTGLRAFGFTLRQCYQQVGCLLLFIAMGIFTFSAAVYSVE--HDVP 437
            :|....::||.|:.||.|||.|||....|.:...:::..|:.|:.:||..|::..|..|  .|.|
  Fly   375 LLEAFSIVRIMRLFKLTRHSPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLAYYAEKLQDNP 439

Human   438 STNFTTIPHSWWWAAVSISTVGYGDMYPETHLGRFFAFLCIAFGIILNGMPISILYNKFSDYYSK 502
            ...|.:||...|||.|:::||||||:.|:|:.|.|...||...|::...:|:.::.:.||.:||.
  Fly   440 DNQFKSIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVSNFSMFYSH 504

Human   503 LKAYEYTTIRRERGEVNFMQRARKK 527
            .:|  .:.:.::|..|..:::.|:|
  Fly   505 TQA--RSKLPKKRRRVLPVEQPRRK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNV2NP_598004.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..93
BTB 99..190 CDD:321966 31/88 (35%)
Ion_trans 266..504 CDD:306908 83/345 (24%)
Selectivity filter. /evidence=ECO:0000250 457..462 4/4 (100%)
ShawlNP_001097131.2 BTB 7..99 CDD:197585 33/98 (34%)
BTB_2 7..97 CDD:280393 32/96 (33%)
Ion_trans 307..506 CDD:278921 66/213 (31%)
Ion_trans_2 <449..499 CDD:285168 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D818306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.