DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1b and Antp

DIOPT Version :9

Sequence 1:XP_006497809.1 Gene:Lmx1b / 16917 MGIID:1100513 Length:408 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:128 Identity:34/128 - (26%)
Similarity:49/128 - (38%) Gaps:26/128 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse   204 PAKGQGSQSKG---------SGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLA 259
            |::...|||.|         ....||...| ||.|...|..|....:..|..:....|:.|..:|
  Fly   268 PSQNPNSQSSGMPSPLYPWMRSQFGKCQER-KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIA 331

Mouse   260 AETGLSVRVVQVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQEVLSSRMEGMMASYTPLAPPQ 322
            ....|:.|.:::||||:|.|.||    ..:.:.:..|...|.|:            ||...||
  Fly   332 HALCLTERQIKIWFQNRRMKWKK----ENKTKGEPGSGGEGDEI------------TPPNSPQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1bXP_006497809.1 LIM1_Lmx1b 62..114 CDD:188757
LIM2_Lmx1a_Lmx1b 121..175 CDD:188764
Homeobox 228..282 CDD:365835 15/53 (28%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 11/38 (29%)
Homeobox 301..354 CDD:395001 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.