DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gzmm and CG10041

DIOPT Version :9

Sequence 1:NP_032530.1 Gene:Gzmm / 16904 MGIID:99549 Length:264 Species:Mus musculus
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:271 Identity:74/271 - (27%)
Similarity:125/271 - (46%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 CWSLLLLLALKTLWAAGNR-----------------FETQIIGGREAVPHSRPYMASLQKAKSHV 51
            ||..|..:|.....:|...                 ..|::|..|...|:......:|:....|:
  Fly     3 CWQSLCSIAWFAAMSAAQETLSDTPQNSTPLLATTVSTTKVISFRPRYPYIVSIGENLKGYYKHL 67

Mouse    52 CGGVLVHRKWVLTAAHCL-SEPLQNLKLVLGLHNLHDLQDPGLTFYIREAIKHPGYNHKYENDLA 115
            |.||::..::||:||||: :.|.:.|.:..|..:|:..:.  ..|::.|...||.:.....||:|
  Fly    68 CVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQ--TRFFVVERRWHPQFRVLGGNDIA 130

Mouse   116 LLKLDRRVQPSKNVKPLALPRKPRSKPAEGTWCSTAGWGMTHQGGPRARALQELDLRVLDTQMCN 180
            :|::..:. |..:|:..::....:.:...||..|..|||....|  :.|.|||:....::...|.
  Fly   131 VLRIYPKF-PLDDVRFRSINFAGKPQRDSGTQASLVGWGRVGVG--KIRKLQEMPFLTMENDECQ 192

Mouse   181 NS-RFWNGVLIDSM-LCLKAGSKSQAPCKGDSGGPLV-CGKGQVDGILSFSSKTCTDIFKPPVAT 242
            .| ||   |.:..: :|.......:.||.||||.||: ..|.::.|:||:..|.||.: ||...|
  Fly   193 QSHRF---VFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKEKLYGLLSYGRKACTPL-KPYAFT 253

Mouse   243 AVAPYSSWIRK 253
            .:..|||||::
  Fly   254 RINAYSSWIQE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GzmmNP_032530.1 Tryp_SPc 27..254 CDD:238113 68/231 (29%)
Tryp_SPc 27..251 CDD:214473 66/227 (29%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 66/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.