DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lipg and CG6295

DIOPT Version :9

Sequence 1:NP_034850.3 Gene:Lipg / 16891 MGIID:1341803 Length:500 Species:Mus musculus
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:313 Identity:94/313 - (30%)
Similarity:149/313 - (47%) Gaps:59/313 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse    49 VAFNIRTSKD---PEQ-EGCNLSLGDSKLLENCGFNMTAKTFFIIHGWTMS-------GMFESWL 102
            |.|.:.|:.:   |:: :..:.|:..|.      ||....|.|.||||:.|       |:.::| 
  Fly    64 VTFYLYTNSNRNSPQEIKATSASISGSH------FNPNHPTRFTIHGWSSSKDEFINYGVRDAW- 121

Mouse   103 HKLVSALQMREKDANVVVVDWLPLAHQLYTDAVNNTRVVGQRVAGMLDWLQEKEEFSLGNVHLIG 167
                    ....|.|::.|||.......|..:|.....||::||.::::::.....:|.|..:||
  Fly   122 --------FTHGDMNMIAVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIG 178

Mouse   168 YSLGAHVAGYAGNFVK-GTVGRITGLDPAGPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLSIG 231
            :||||||:||||..|| |.:..|.|||||.|:|.....|:|||..||.:|:.:.|.    |.::|
  Fly   179 HSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTN----GGTLG 239

Mouse   232 IRMPVGHIDIYPNGGDFQPGCGFNDVIGSFAYGTISEMVKCEHERAVHLFVDSLVNQDKPSFAFQ 296
            ...|:|....|||||..|||||. |:.||           |.|.|:|..:.:|:...:.|:  .:
  Fly   240 FLKPIGKGAFYPNGGKSQPGCGV-DLTGS-----------CAHSRSVIYYAESVTENNFPT--MR 290

Mouse   297 CTDSSRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKM-----YLKTRAGMPF 344
            |.|   ::..:...|..:      |::.:|....|:.|     |:..|:..|:
  Fly   291 CGD---YEEAVAKECGSS------YSSVRMGATTNAYMVAGDYYVPVRSDAPY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LipgNP_034850.3 Pancreat_lipase_like 49..340 CDD:238363 92/307 (30%)
lipo_lipase 51..485 CDD:132274 93/311 (30%)
Heparin-binding. /evidence=ECO:0000250 325..337 4/16 (25%)
PLAT_LPL 347..483 CDD:238856
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 92/307 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835328
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.