DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lhx8 and ey

DIOPT Version :9

Sequence 1:NP_034843.2 Gene:Lhx8 / 16875 MGIID:1096343 Length:367 Species:Mus musculus
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:124 Identity:39/124 - (31%)
Similarity:58/124 - (46%) Gaps:27/124 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse   221 EVENGNGISVEGAL---LTEQDVNH---PKPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKL 279
            |.||.||    ||.   .||.|...   .:..:|.|||||.||:..::.:|.:.:.||....::|
  Fly   444 EGENSNG----GASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERL 504

Mouse   280 AERTGLSRRVIQVWFQNCRARHKKH-----------------VSPNHSSSAPVTAVPSS 321
            |.:.||....|||||.|.||:.::.                 .|.:.|::|.:|..|:|
  Fly   505 AGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNS 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lhx8NP_034843.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..79
LIM1_Lhx7_Lhx8 95..150 CDD:188767
LIM2_Lhx7_Lhx8 157..211 CDD:188769
Homeobox 250..302 CDD:278475 22/51 (43%)
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.