DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BHLHA15 and sage

DIOPT Version :9

Sequence 1:NP_803238.1 Gene:BHLHA15 / 168620 HGNCID:22265 Length:189 Species:Homo sapiens
Sequence 2:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster


Alignment Length:82 Identity:31/82 - (37%)
Similarity:43/82 - (52%) Gaps:9/82 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    70 RDSSIQR----RLESNERERQRMHKLNNAFQALREVIPHVRAD-KKLSKIETLTLAKNYIKSLTA 129
            |:.::|.    |..:.:|||.||..:|.||..||..:|..:.: ||.||||:|.:|.|||..|.|
  Fly   170 REKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQA 234

Human   130 TILTMSSSRLPGLEGPG 146
            .:...|    .|..|.|
  Fly   235 MLRESS----VGQNGNG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BHLHA15NP_803238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85 4/18 (22%)
HLH 81..127 CDD:197674 22/46 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..189
sageNP_524287.1 HLH 181..233 CDD:278439 23/51 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.