DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BHLHA15 and tap

DIOPT Version :9

Sequence 1:NP_803238.1 Gene:BHLHA15 / 168620 HGNCID:22265 Length:189 Species:Homo sapiens
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:246 Identity:56/246 - (22%)
Similarity:82/246 - (33%) Gaps:111/246 - (45%)


- Green bases have known domain annotations that are detailed below.


Human     7 PPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRRPGPSGPGGRRD 71
            ||....||:..|        |.:.|.|..:.|.| ::|..|  :|:|.:..:.:.          
  Fly   110 PPLTSTPVKSPE--------DPNAPRPKRKYAVG-KNRVTR--SRSPTQVVKIKR---------- 153

Human    72 SSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATI----- 131
               .||:::|:|||.|||.||:|.:.||..:|.:..:.||:|||.|..|.|||.:|...:     
  Fly   154 ---FRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGS 215

Human   132 ----------LTMSSSRL----------------------------------------------- 139
                      .|:|..|:                                               
  Fly   216 INLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGRMFPYGQGMAPLAQHQTAPASHAEQPPA 280

Human   140 --------------PGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQ 176
                          ||.:..|...:.|.||||          ..||. |||
  Fly   281 MGGFQHGMDYPQQPPGFDFTGSMRFYHQQQQQ----------PHQPH-HLQ 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BHLHA15NP_803238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85 18/77 (23%)
HLH 81..127 CDD:197674 23/45 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..189 5/10 (50%)
tapNP_524124.1 HLH 155..207 CDD:278439 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.