DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF133 and HRD1

DIOPT Version :9

Sequence 1:NP_631914.1 Gene:RNF133 / 168433 HGNCID:21154 Length:376 Species:Homo sapiens
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:287 Identity:58/287 - (20%)
Similarity:93/287 - (32%) Gaps:90/287 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   104 LIERGGCTFTQKIKVATEKGASGVIIYNVPGTGNQVFPMFHQAFEDVVVVMIGNLKGTEIFHLIK 168
            :.|:....||:.:|.|..  .|.:|.:.:|          ....:|||         .:|..|.:
Yeast   269 MYEKAIDVFTRFLKTALH--LSMLIPFRMP----------MMLLKDVV---------WDILALYQ 312

Human   169 KGVLITAVVEVGRKHIIWMNHYLVSFVIVTTATLAYFIFYHIHRLCLARIQNRRWQRLTTDLQNT 233
            .|..:..         ||.|:..:...:||..                          ...|||:
Yeast   313 SGTSLWK---------IWRNNKQLDDTLVTVT--------------------------VEQLQNS 342

Human   234 FGQLQLRVVKEGDEEINPNGDSCVICFER--YKPNDIV--------RILTCKHFFHKNCIDPWIL 288
                      ..|:.|      |:||.:.  :.||...        :.|.|.|..|.:|:..|:.
Yeast   343 ----------ANDDNI------CIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWME 391

Human   289 PHGTCPICKCDILKVLGIQVVVENGTEPLQVLMSNELPET--LSPSEEETNNEVS--PAGTSDKV 349
            ...|||||:..:....| .||....|....:.....:.::  ::..::...|||.  |..|:...
Yeast   392 RSQTCPICRLPVFDEKG-NVVQTTFTSNSDITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPD 455

Human   350 IHVEENPTSQNNDIQPHSVVEDVHPSP 376
            |.:.  || ||.|...........|||
Yeast   456 IRIV--PT-QNIDTLAMRTRSTSTPSP 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF133NP_631914.1 PA_GRAIL_like 43..177 CDD:239037 14/72 (19%)
RING_Ubox 254..302 CDD:327409 16/57 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..376 12/52 (23%)
HRD1NP_014630.1 HRD1 5..551 CDD:227568 58/287 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.