DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF133 and gol

DIOPT Version :9

Sequence 1:NP_631914.1 Gene:RNF133 / 168433 HGNCID:21154 Length:376 Species:Homo sapiens
Sequence 2:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster


Alignment Length:289 Identity:87/289 - (30%)
Similarity:141/289 - (48%) Gaps:59/289 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    79 EGKIQN------------------ACNPNTIFSRSKY-------SETWLALIERGGCTFTQKIKV 118
            |||:.|                  ||.|   :.|...       .|||:||:.||.|||.:|:|.
  Fly    97 EGKVLNVTGRLIHITATDNFSDDYACTP---YIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKH 158

Human   119 ATEKGASGVIIYNVPGTGNQVFPMFHQAFED-----VVVVMIGNLKGTEIFHLIKKGVLITAVVE 178
            ..::.|:||||||    ..||..:.....:.     ..|:...|: |.::...:.||..:|..:.
  Fly   159 VYQQNAAGVIIYN----DKQVMQLEKMQIKGKTRNIAAVITYQNI-GQDLSLTLDKGYNVTISII 218

Human   179 VGRK-----------HIIWMNHYLVSFVIVTTATLAYFIFYHIHRLCLARIQNRRWQRLTTDLQN 232
            .||:           .:::::   :||:::...:|.:.|||:|.|....:.::::.:.|.:..:.
  Fly   219 EGRRGVRTISSLNRTSVLFVS---ISFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKK 280

Human   233 TFGQLQLRVVKEGDEEINPNGDSCVICFERYKPNDIVRILTCKHFFHKNCIDPWILPHGTCPICK 297
            ...::..:..|..||: :.:.|.|.||.|.|||.|.:|||.|||.|||||||||::.|.|||:||
  Fly   281 AIMKIPTKTGKFSDEK-DLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCK 344

Human   298 CDILKVLGI------QVVVENGTEPLQVL 320
            .|:||..|.      :.::|...:|.|.|
  Fly   345 LDVLKFYGYVFLGSEESILEYQPDPPQGL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF133NP_631914.1 PA_GRAIL_like 43..177 CDD:239037 35/127 (28%)
RING_Ubox 254..302 CDD:327409 31/47 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..376
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 35/127 (28%)
UPF0233 226..>258 CDD:299753 6/34 (18%)
zf-RING_2 301..344 CDD:290367 28/42 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X295
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.