DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF133 and H10E21.5

DIOPT Version :9

Sequence 1:NP_631914.1 Gene:RNF133 / 168433 HGNCID:21154 Length:376 Species:Homo sapiens
Sequence 2:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans


Alignment Length:163 Identity:51/163 - (31%)
Similarity:88/163 - (53%) Gaps:10/163 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   192 VSFVIVTTATLAYFIFYHIHRLCLARIQNRRWQRLTTDLQNTFGQLQLRVVKEG-DEEINPNGDS 255
            :||:|:...:||:.:||::.|...|..::|..:||....:....::....:..| .:|:.   ..
 Worm   165 ISFIILMVISLAWLVFYYVQRFRYAHAKDRLQRRLFNAARKALTRIPTMTITPGMTQELQ---SD 226

Human   256 CVICFERYKPNDIVRILTCKHFFHKNCIDPWILPHGTCPICKCDILKVLGIQVVVENGTE-PLQV 319
            |.:|.:.|:..|::|:|.|||.:||:|||||:|.|.|||:||.||||..|....:.|..: |...
 Worm   227 CAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDILKHFGYWNDIRNDIQMPTNS 291

Human   320 L-MSNELPETLSPSEEE----TNNEVSPAGTSD 347
            . ::::....|...|:|    :.:.:||...||
 Worm   292 RGIADDFTIRLELGEQEHQAPSADVISPEANSD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF133NP_631914.1 PA_GRAIL_like 43..177 CDD:239037
RING_Ubox 254..302 CDD:327409 25/47 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..376 7/25 (28%)
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 51/163 (31%)
RING-H2_GRAIL 226..273 CDD:319582 25/46 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm15229
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X295
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.970

Return to query results.
Submit another query.