DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment L1cam and klg

DIOPT Version :10

Sequence 1:NP_032504.3 Gene:L1cam / 16728 MGIID:96721 Length:1259 Species:Mus musculus
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:487 Identity:117/487 - (24%)
Similarity:189/487 - (38%) Gaps:96/487 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse   316 SLGSARHAYY----VTVEAA----------------------------PYWLQKPQSHLYGPGET 348
            |||...||:.    ..||||                            |.:|.:..::....|:|
  Fly    53 SLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDT 117

Mouse   349 ARLDCQVQGRPQPEITWRINGMSMET-----VNKDQKYRIEQG-SLILSNVQPSDTMVTQCEARN 407
            ..|.|||:......:.|| .|.::.|     |.:|::.|:..| :|.:|:::|.|.....|:..:
  Fly   118 LVLPCQVENLGNFVLLWR-RGTNVLTASNIMVTRDERVRLIDGYNLEISDLEPQDAGDYVCQISD 181

Mouse   408 QHGLLLANAYIYVVQL----PARILTKDNQTYMAVEGSTAYLLCKAFGAPVPSVQWLDEEG---- 464
            :    :....::.|::    ..|.:....| ..|.:|....|.||..|.||||:.|..:.|    
  Fly   182 K----INRDQVHTVEILVPPSVRAIPTSGQ-LQARKGGPITLECKGSGNPVPSIYWTKKSGANKS 241

Mouse   465 TTVLQDERFFPYANGTLSIRDLQANDTGRYFCQAANDQNN-VTILANLQVKEATQITQGPRSAIE 528
            |..:.|       ...|::..|:....|.|.|.|.|...: ||:...|.|.....| |..:|.|.
  Fly   242 TARIGD-------GPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDI-QVEKSWIH 298

Mouse   529 K-KGARVTFTCQASFDPSLQASITWRGDGRDLQERGDSDKYFI----EDGKLVIQSLDYSDQGNY 588
            . :|......|....||  .|:::|..:...:|   .:|:..:    ....|.|:.:...|.|||
  Fly   299 SGEGFEAKLVCIVFADP--VATVSWYQNSFPIQ---STDRRIMATRANRHMLTIRHIQQEDFGNY 358

Mouse   589 SCVASTELDEVESRAQLLVVGSPGPVPHLELSDRHLLKQSQVHLSWSPAEDHNSPIEKYDIEFED 653
            ||||...|.  .||..:.:.|.||....  .|.:........:|:|.  .|...|:|:..:.:..
  Fly   359 SCVADNSLG--RSRKYMELSGRPGAAEF--YSPKWGRSPDSYNLTWK--IDSYPPLEEVRLLYRR 417

Mouse   654 KEM-----APEKWFSLGKVPGNQ---------TSTTLK-LSPYVHYTFRVTAINKYGPGEPSPVS 703
            .:|     .|.:|......|.::         .|.|:| |.|..:|...|.|.|:||..|.|.:.
  Fly   418 VQMNETYQQPGRWHDFILTPEHRPASEPLTHIMSYTIKNLHPGGYYEAIVQAKNRYGWNEVSDIF 482

Mouse   704 ETVV---TPEAAPEKNPVDVRGEGNETNNMVI 732
            :.||   :.:..||...| |....:.:|:..|
  Fly   483 QFVVATNSQDIGPEDAEV-VASSKSRSNSASI 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
L1camNP_032504.3 IgI_L1-CAM_like 35..130 CDD:409396
Ig strand A 35..39 CDD:409396
Ig strand A' 44..48 CDD:409396
Ig strand B 53..60 CDD:409396
Ig strand C 66..71 CDD:409396
Ig strand C' 74..76 CDD:409396
Ig strand D 83..86 CDD:409396
Ig strand E 93..97 CDD:409396
Ig strand F 109..117 CDD:409396
Ig strand G 120..130 CDD:409396
Ig 139..229 CDD:472250
Ig strand B 153..157 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 190..194 CDD:409353
Ig strand F 205..210 CDD:409353
Ig strand G 221..224 CDD:409353
Ig3_L1-CAM 247..329 CDD:409460 5/16 (31%)
Ig strand B 259..263 CDD:409460
Ig strand C 272..276 CDD:409460
Ig strand E 294..298 CDD:409460
Ig strand F 308..313 CDD:409460
Ig strand G 321..324 CDD:409460 1/2 (50%)
Ig 333..421 CDD:472250 20/93 (22%)
Ig strand B 349..353 CDD:409353 1/3 (33%)
Ig strand C 362..366 CDD:409353 0/3 (0%)
Ig strand E 386..390 CDD:409353 2/4 (50%)
Ig strand F 400..405 CDD:409353 1/4 (25%)
Ig strand G 413..416 CDD:409353 0/2 (0%)
Ig 427..513 CDD:472250 25/90 (28%)
Ig strand B 443..447 CDD:409353 1/3 (33%)
Ig strand C 456..460 CDD:409353 1/3 (33%)
Ig strand E 479..483 CDD:409353 1/3 (33%)
Ig strand F 493..498 CDD:409353 2/4 (50%)
Ig strand G 506..509 CDD:409353 1/2 (50%)
Ig 515..611 CDD:472250 26/100 (26%)
Ig strand B 534..538 CDD:409353 0/3 (0%)
Ig strand C 549..553 CDD:409353 0/3 (0%)
Cell attachment site. /evidence=ECO:0000255 553..555 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 562..564 0/1 (0%)
Ig strand E 573..577 CDD:409353 1/3 (33%)
Ig strand F 587..592 CDD:409353 4/4 (100%)
Ig strand G 600..603 CDD:409353 1/2 (50%)
FN3 611..708 CDD:238020 27/114 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..724 8/29 (28%)
fn3 717..798 CDD:394996 4/16 (25%)
fn3 824..906 CDD:394996
FN3 917..1002 CDD:238020
Bravo_FIGEY 1146..1235 CDD:464016
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1182..1209
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1228..1259
klgNP_524454.2 IG_like 109..195 CDD:214653 20/90 (22%)
Ig strand B 118..122 CDD:409353 1/3 (33%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 1/3 (33%)
Ig strand F 174..179 CDD:409353 1/4 (25%)
Ig strand G 188..191 CDD:409353 0/2 (0%)
Ig_3 196..270 CDD:464046 22/81 (27%)
Ig_3 287..364 CDD:464046 22/82 (27%)
FN3 392..486 CDD:238020 22/95 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.