DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment L1cam and robo1

DIOPT Version :10

Sequence 1:NP_032504.3 Gene:L1cam / 16728 MGIID:96721 Length:1259 Species:Mus musculus
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:1048 Identity:246/1048 - (23%)
Similarity:389/1048 - (37%) Gaps:292/1048 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse     9 WPLL-LCSPCLLIQIPDEYKGHHVLEPPVITEQSPRRLVVFPTDDISLKCEARGRPQVEFRWTKD 72
            |.|| |.:...|..:..:|:...::|       .|..|||...:..:|.|:..|:|:....|.||
  Fly    35 WLLLVLVASNGLPAVRGQYQSPRIIE-------HPTDLVVKKNEPATLNCKVEGKPEPTIEWFKD 92

Mouse    73 GIHFKPKEELGVVVHEAPY-SGSF----TIEGNNSFAQRFQGIYRCYASNKLGTAMSHEIQLVAE 132
            |......|:..   |...: .|:.    |::|..   ::..|.|.|.|.|::|.|:|....|   
  Fly    93 GEPVSTNEKKS---HRVQFKDGALFFYRTMQGKK---EQDGGEYWCVAKNRVGQAVSRHASL--- 148

Mouse   133 GAPKWPKETVKPVEVEEGESVVLPCNPPPSAAPLRIYWMNSKILHIKQDERVSMGQNGDLYFANV 197
                                                     :|..::.|.||             
  Fly   149 -----------------------------------------QIAVLRDDFRV------------- 159

Mouse   198 LTSDNHSDYICNAHFPGTRTIIQKEPIDLRVKPTNSMIDRKPRLLFPTNSSSRLVALQGQSLILE 262
                                    ||.|.||                         .:|::.:||
  Fly   160 ------------------------EPKDTRV-------------------------AKGETALLE 175

Mouse   263 C-IAEGFPTPTIKWLHPSDPMPTD-------------RVIYQNHNKTLQLLNVGEEDDGEYTCLA 313
            | ..:|.|.||:.|:  .|.:|.|             |::   ....|.:.||...|:|.|.|:|
  Fly   176 CGPPKGIPEPTLIWI--KDGVPLDDLKAMSFGASSRVRIV---DGGNLLISNVEPIDEGNYKCIA 235

Mouse   314 ENSLGSARHAY-YVTVEAAPYWLQKPQSHLYGPGETARLDCQVQGRPQPEITWRIN----GMSME 373
            :|.:|:...:| .:.|:..||::::|:..:...|:||...|.|.|.|.|::.|:..    .:|..
  Fly   236 QNLVGTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEGNIPVSRA 300

Mouse   374 TVNKDQKYRIEQGSLILSNVQPSDTMVTQCEARNQHGLLLANAYIYVVQLPARILTKDNQTYMAV 438
            .:..|:|      ||.:||:.|:|.....|||.|..|.:.|.|.: :|..|.....:.:...:.:
  Fly   301 RILHDEK------SLEISNITPTDEGTYVCEAHNNVGQISARASL-IVHAPPNFTKRPSNKKVGL 358

Mouse   439 EGSTAYLLCKAFGAPVPSVQWLDEEGTTVLQDERFFP---------YANGTLSIRDLQANDTGRY 494
            .| ...|.|.|.|.|.|||.|..|..:|::     ||         .|:|||.|.|::..|.|.|
  Fly   359 NG-VVQLPCMASGNPPPSVFWTKEGVSTLM-----FPNSSHGRQHVAADGTLQITDVRQEDEGYY 417

Mouse   495 FCQAANDQNNVTILANLQVKEATQ-----ITQGPRSAIEKKGARVTFTCQASFDPSLQASITWRG 554
            .|.|.:..::.|:...|||....:     |..||.:....||:..|..|:|:.:||  ..|.|..
  Fly   418 VCSAFSVVDSSTVRVFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPS--PRIKWFH 480

Mouse   555 DGRDLQERGDSDKY-FIEDGKLVIQSLDYSDQGNYSCVASTELDEVESRAQLLVVGSPG------ 612
            ||..:|.   .::| .|:...|.:..|..||.|.|:|.||.|..|. |.|..|.|..||      
  Fly   481 DGHAVQA---GNRYSIIQGSSLRVDDLQLSDSGTYTCTASGERGET-SWAATLTVEKPGSTSLHR 541

Mouse   613 -------PVPH-----LELSDRHLLKQSQVHLSWSPAEDHN---SPIEKYDIEFEDKEMAPEKWF 662
                   |.|.     |.:|      ::.:.|.|:.:::..   .||..|.:|:...:: ...|.
  Fly   542 AADPSTYPAPPGTPKVLNVS------RTSISLRWAKSQEKPGAVGPIIGYTVEYFSPDL-QTGWI 599

Mouse   663 SLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEA---APEKNPVDVRGEG 724
            ...:..|:...|...|:|...|.|.|.|.|..|...||.:|.|:.|.||   |...|.:...   
  Fly   600 VAAQRVGDTQVTISGLTPGTSYVFLVRAENTQGISVPSGLSNTIKTIEADFDAASANDLSAA--- 661

Mouse   725 NETNNMVITWKPLRWMDWNAPQIQ-YRVQWR----------------------PQGKQETWREQT 766
                ..::|.|.:..:|.:|.... .|::|.                      |..:..:.....
  Fly   662 ----RTLLTGKSVELIDASAINASAVRLEWMLHVSADEKYVEGLRIHYKDASVPSAQYHSITVMD 722

Mouse   767 VSDPFLVVSNTSTFVPYEIKV----QAVNNQGKGPEPQVTIGYSGEDYPQVSPELEDITIFNSST 827
            .|....||.|...:..||..:    :.:..|....:..:|.    ||.|...|:...|.::|.:.
  Fly   723 ASAESFVVGNLKKYTKYEFFLTPFFETIEGQPSNSKTALTY----EDVPSAPPDNIQIGMYNQTA 783

Mouse   828 VLVRWRPVDLAQVKGHLKGYNVTYWWKGSQRKHSKRHIHK--SHIVVPANTTSAILSGLRPYSSY 890
            ..|||.|.......|:|.||.:         :.|..:..|  :::.:.|.|||.:|:.|...:.|
  Fly   784 GWVRWTPPPSQHHNGNLYGYKI---------EVSAGNTMKVLANMTLNATTTSVLLNNLTTGAVY 839

Mouse   891 HVEVQAFNGRGLGPASEWTFSTPEGV---PGHPEALHLECQSDTSLLLHWQPPL-----SHNGVL 947
            .|.:.:|...|.||     :|.|..:   |.|                |..||.     :|:|..
  Fly   840 SVRLNSFTKAGDGP-----YSKPISLFMDPTH----------------HVHPPRAHPSGTHDGRH 883

Mouse   948 TGYLLSYH 955
            .|..|:||
  Fly   884 EGQDLTYH 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
L1camNP_032504.3 IgI_L1-CAM_like 35..130 CDD:409396 25/99 (25%)
Ig strand A 35..39 CDD:409396 0/3 (0%)
Ig strand A' 44..48 CDD:409396 2/3 (67%)
Ig strand B 53..60 CDD:409396 2/6 (33%)
Ig strand C 66..71 CDD:409396 1/4 (25%)
Ig strand C' 74..76 CDD:409396 0/1 (0%)
Ig strand D 83..86 CDD:409396 0/2 (0%)
Ig strand E 93..97 CDD:409396 1/7 (14%)
Ig strand F 109..117 CDD:409396 4/7 (57%)
Ig strand G 120..130 CDD:409396 3/9 (33%)
Ig 139..229 CDD:472250 8/89 (9%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 167..171 CDD:409353 0/3 (0%)
Ig strand E 190..194 CDD:409353 0/3 (0%)
Ig strand F 205..210 CDD:409353 0/4 (0%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig3_L1-CAM 247..329 CDD:409460 24/96 (25%)
Ig strand B 259..263 CDD:409460 1/3 (33%)
Ig strand C 272..276 CDD:409460 1/3 (33%)
Ig strand E 294..298 CDD:409460 1/3 (33%)
Ig strand F 308..313 CDD:409460 2/4 (50%)
Ig strand G 321..324 CDD:409460 0/2 (0%)
Ig 333..421 CDD:472250 27/91 (30%)
Ig strand B 349..353 CDD:409353 1/3 (33%)
Ig strand C 362..366 CDD:409353 0/3 (0%)
Ig strand E 386..390 CDD:409353 2/3 (67%)
Ig strand F 400..405 CDD:409353 1/4 (25%)
Ig strand G 413..416 CDD:409353 1/2 (50%)
Ig 427..513 CDD:472250 27/94 (29%)
Ig strand B 443..447 CDD:409353 1/3 (33%)
Ig strand C 456..460 CDD:409353 2/3 (67%)
Ig strand E 479..483 CDD:409353 3/3 (100%)
Ig strand F 493..498 CDD:409353 2/4 (50%)
Ig strand G 506..509 CDD:409353 1/2 (50%)
Ig 515..611 CDD:472250 32/101 (32%)
Ig strand B 534..538 CDD:409353 1/3 (33%)
Ig strand C 549..553 CDD:409353 1/3 (33%)
Cell attachment site. /evidence=ECO:0000255 553..555 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 562..564 0/1 (0%)
Ig strand E 573..577 CDD:409353 1/3 (33%)
Ig strand F 587..592 CDD:409353 2/4 (50%)
Ig strand G 600..603 CDD:409353 1/2 (50%)
FN3 611..708 CDD:238020 27/117 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..724 9/29 (31%)
fn3 717..798 CDD:394996 14/107 (13%)
fn3 824..906 CDD:394996 23/83 (28%)
FN3 917..1002 CDD:238020 11/44 (25%)
Bravo_FIGEY 1146..1235 CDD:464016
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1182..1209
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1228..1259
robo1NP_476899.1 Ig 56..151 CDD:472250 27/151 (18%)
Ig strand B 73..77 CDD:409353 1/3 (33%)
Ig strand C 86..90 CDD:409353 0/3 (0%)
Ig strand E 111..115 CDD:409353 1/3 (33%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig strand G 143..146 CDD:409353 1/2 (50%)
IgI_2_Robo 158..251 CDD:409389 31/159 (19%)
Ig strand A 158..161 CDD:409389 2/39 (5%)
Ig strand A' 163..167 CDD:409389 3/28 (11%)
Ig strand B 171..178 CDD:409389 3/6 (50%)
Ig strand C 186..191 CDD:409389 2/6 (33%)
Ig strand C' 193..196 CDD:409389 0/2 (0%)
Ig strand D 209..213 CDD:409389 1/3 (33%)
Ig strand E 216..222 CDD:409389 1/5 (20%)
Ig strand F 229..237 CDD:409389 4/7 (57%)
Ig strand G 240..251 CDD:409389 2/10 (20%)
IgI_3_Robo 258..341 CDD:409390 26/89 (29%)
Ig strand A 258..261 CDD:409390 0/2 (0%)
Ig strand A' 263..267 CDD:409390 0/3 (0%)
Ig strand B 270..279 CDD:409390 3/8 (38%)
Ig strand C 285..290 CDD:409390 1/4 (25%)
Ig strand C' 293..296 CDD:409390 0/2 (0%)
Ig strand D 299..304 CDD:409390 0/4 (0%)
Ig strand E 305..313 CDD:409390 4/13 (31%)
Ig strand F 320..328 CDD:409390 3/7 (43%)
Ig strand G 331..341 CDD:409390 3/10 (30%)
Ig 346..437 CDD:472250 28/96 (29%)
Ig strand B 362..366 CDD:409353 1/3 (33%)
Ig strand C 375..379 CDD:409353 2/3 (67%)
Ig strand E 402..406 CDD:409353 3/3 (100%)
Ig strand F 416..421 CDD:409353 2/4 (50%)
Ig strand G 429..432 CDD:409353 1/2 (50%)
Ig 446..531 CDD:472250 31/90 (34%)
Ig strand B 462..466 CDD:409544 1/3 (33%)
Ig strand C 475..479 CDD:409544 1/3 (33%)
Ig strand E 497..501 CDD:409544 1/3 (33%)
FN3 507..>916 CDD:442628 101/434 (23%)
Ig strand F 511..516 CDD:409544 2/4 (50%)
Ig strand G 524..527 CDD:409544 1/2 (50%)
FN3 549..637 CDD:238020 21/94 (22%)
fn3 770..855 CDD:394996 25/98 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.