DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krt1 and LamC

DIOPT Version :9

Sequence 1:NP_032499.2 Gene:Krt1 / 16678 MGIID:96698 Length:637 Species:Mus musculus
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:467 Identity:109/467 - (23%)
Similarity:205/467 - (43%) Gaps:99/467 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse   140 GGGFGGGRFGSMGPVCPPGGIQEVTINQSLLQPLNVEVDPQIQKVKSQEREQIKSLNDKFASFID 204
            ||.....|.|:..|..|                        .:..:.||:|:::.|||:.|.:||
  Fly    22 GGASTSSRVGATSPTSP------------------------TRTSRQQEKEELQHLNDRLACYID 62

Mouse   205 KVRFLEQQNQVLQTKWELLQQVDTTTR-TQNLDPFFENYISILRRKVDSLKSDQSRMDSELKNM- 267
            ::|.||.:|..|..:..|.|  ||..| |.||...:|..::..|:.:|....::::::.::|.: 
  Fly    63 RMRNLENENSRLTQELNLAQ--DTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLW 125

Mouse   268 ---------------------------------------QDLVEEYRTKYEDEINKRTNAENEFV 293
                                                   |.|.:  |.|:||:. |....|||.:
  Fly   126 EENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLAD--RKKFEDQA-KELALENERL 187

Mouse   294 -----TIKKDVDSAYMTKVELQAKADALQQDIDFFSALYQMEM----SQMQTQISETNVVLSMDN 349
                 .::|.:::..:.:|:|:.:..:|::::.|...::..|:    |:.|.:|||.:..||...
  Fly   188 RRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQY 252

Mouse   350 NRSLDLDGIISEVKAQYDSICQRSKAEAETFYQSKYEELQITAGKHG-------DSVRNTKMEIS 407
            ...|...  :.|::.||:...:.::.|.|..|.::.:.|:..|.:..       :.||..:.:|.
  Fly   253 EAKLQQS--LQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKID 315

Mouse   408 ELNRMIQRLRSEIDGCKKQISQIQQNINDAEQRGEKALKDAQNKLNEIEDALSQCKEDLARLLRD 472
            .||..:|.|.....|...:|.:::..::...||..:.:.       .:|..|.:.::::|..|::
  Fly   316 GLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIA-------SLEAELQRMRDEMAHQLQE 373

Mouse   473 FQELMNTKLALDMEIATYKKLLEGEEIRMS----GECTPNVSVSVSTSHTSMSGSSSRGGGSGGG 533
            :|.||:.|::||:|||.|.|||.|||.|::    |..|.:..:|.:.||.:.|.||..|..:..|
  Fly   374 YQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRVTPSG 438

Mouse   534 RYGGGGSYGGGS 545
            |........|.|
  Fly   439 RRSATPGISGSS 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Krt1NP_032499.2 Head 1..187 6/46 (13%)
Keratin_2_head <153..184 CDD:292825 2/30 (7%)
Filament 187..500 CDD:278467 89/369 (24%)
Coil 1A 188..223 13/34 (38%)
Linker 1 224..243 8/19 (42%)
Coil 1B 244..334 20/138 (14%)
Linker 12 335..358 7/22 (32%)
Coil 2 359..497 36/144 (25%)
DUF342 <390..504 CDD:302792 33/124 (27%)
Tail 498..637 15/52 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 505..533 8/27 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 563..637
LamCNP_001260974.1 Filament 45..401 CDD:278467 89/369 (24%)
ATP-synt_B <67..>142 CDD:304375 16/76 (21%)
MreC <178..>224 CDD:302802 9/45 (20%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.