DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krt17 and mud

DIOPT Version :9

Sequence 1:NP_034793.1 Gene:Krt17 / 16667 MGIID:96691 Length:433 Species:Mus musculus
Sequence 2:NP_727769.3 Gene:mud / 44839 FlyBaseID:FBgn0002873 Length:2567 Species:Drosophila melanogaster


Alignment Length:411 Identity:84/411 - (20%)
Similarity:168/411 - (40%) Gaps:88/411 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    84 EKATMQNLNDRLASYLDKVR-ALEEANT--ELEVKIRDWYQKQAPGPARDYSAYYHTIEDLKNKI 145
            ||.:.|.|.|.|...|||.| .|.:.|:  |.:.|:.|..|:|.           .:.:.|.:.:
  Fly  1259 EKESAQQLVDNLKVELDKERKELAQVNSAFEAQTKLSDDLQRQK-----------ESAQQLVDNL 1312

Mouse   146 LVATVDNASILLQIDNARLA----ADDFRTKFETEQAL--RMSVEAD-----INGLRRVLDELTL 199
            .|........|.|:::|..|    :||.:.:.|:.|.|  .:.||.|     :..::.|::..|.
  Fly  1313 KVELDKERKELAQVNSAFEAQTKLSDDLQREKESAQQLVDNLKVELDKERKELAQVKSVIEAQTK 1377

Mouse   200 ARADLEMQ-------IENLKEELAYLKKNHEEEMNALRGQ--VGGEINVEMDAAPGVDLSRILS- 254
            ...||:.|       ::|||.||...:|...:..:.:..|  :..::..:.::|..::....|| 
  Fly  1378 LSDDLQRQKESAQQLVDNLKVELDKERKELAKVKSVIEAQTKLSDDLQRQKESAQQLEAQTKLSD 1442

Mouse   255 ----------EMRDQYEKMAEKNRKD---AEDWFFSKT---EELNREVATNSELVQSGKSEISEL 303
                      ::.|..:...:|.||:   .:....::|   ::|.|:..:..:||.:.|.|:.:.
  Fly  1443 DLQRQKESAQQLVDNLKVELDKERKELAQVKSVIEAQTKLSDDLQRQKESAQQLVDNLKMELDKE 1507

Mouse   304 RRTMQALEIELQSQLSMKASLEGSLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEMEQQNQEYK 368
            |:.:..::..:.:|..:...||          | |...:|.|:.:::.:|.:.|.|:.:.|..::
  Fly  1508 RKELAQVKSAIGAQTKLSDDLE----------C-QKESVQQLVDNLKVELEKERKELAKVNSAFE 1561

Mouse   369 I-------------------------LLDVKTRLEQEIATYRRLLEGEDAHLTQYKPKEPVTTRQ 408
            .                         |:..|...|.::||...::|..:...||.:.:......|
  Fly  1562 AQTKLSDDLKLQKEDAQREVFLVKERLVKEKREFEVKLATLEDIIETLEMRCTQMEEERATAYEQ 1626

Mouse   409 VRTIVEEVQD-GKVISSREQV 428
            :..:....|: ..|.||:.||
  Fly  1627 INKLENRCQEKDNVKSSQLQV 1647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Krt17NP_034793.1 Head 1..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Filament 84..394 CDD:333788 75/374 (20%)
Coil 1A 84..120 15/38 (39%)
Linker 1 121..138 2/16 (13%)
Coil 1B 139..230 25/108 (23%)
Linker 12 231..250 2/20 (10%)
Coil 2 251..392 31/182 (17%)
Tail 393..433 9/37 (24%)
mudNP_727769.3 SMC_prok_B 319..1178 CDD:274008
SCP-1 853..1571 CDD:114219 69/333 (21%)
Smc 1234..>1944 CDD:224117 84/411 (20%)
DUF948 1392..1517 CDD:295114 22/124 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11791
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.