DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Krt15 and LamC

DIOPT Version :9

Sequence 1:NP_032495.2 Gene:Krt15 / 16665 MGIID:96689 Length:456 Species:Mus musculus
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:418 Identity:124/418 - (29%)
Similarity:191/418 - (45%) Gaps:84/418 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse    98 EKVTMQNLNDRLASYLDKVRALEQANTELEVKI---RDWYQKQSPASPDRDYSHYFKTMEEIRDK 159
            ||..:|:||||||.|:|::|.||..|:.|..::   :|...:::            ..::.:.:|
  Fly    46 EKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRET------------SNLKAVYEK 98

Mouse   160 ILAAT---IDNS---RVVLEIDNARLAADDFRLK------------YENELTLRQGVEADING-- 204
            .|||.   :|.:   :..||||..||..::..||            .||...|.:....::||  
  Fly    99 ELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKY 163

Mouse   205 -----------------------LRRVLDEL-------TLARTDLEMQIEQLNEELAYLKKNHEE 239
                                   |||.||:|       ||||.|||.|.:.|.||||:..:.|.:
  Fly   164 NQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQ 228

Mouse   240 EMKEFS-------SQLAGQVNVEMDAAPGVDLTRMLAEMREQYEAIAEKNRRDVEAWFFSKTEEL 297
            |:.|..       |::.|:::.:.:|    .|.:.|.|:|:|||.....||.::|..:.::.:.|
  Fly   229 ELTETRSRRQIEISEIDGRLSRQYEA----KLQQSLQELRDQYEGQMRINREEIELLYDNEIQNL 289

Mouse   298 NKEVASNTEMIQTSKTEITDLRRT-LQGLEIELQSQLSMKAGLENSLAEVECRYATQLQQIQGVI 361
             |..|:.........||...|.|| :.||..:||:.....|||...:.|:|....|:.|:....|
  Fly   290 -KAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYI 353

Mouse   362 TGLETQLSELRCEMEAQNQEYNMLLDIKTRLEQEIATYRNLLEGQDAKMAGIGVREVSLGGSSGG 426
            ..||.:|..:|.||..|.|||..|:|||..|:.|||.|..||.|::.::     ...|.|..:..
  Fly   354 ASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRL-----NIESPGRPTTD 413

Mouse   427 GGSSSSSSNFHISVEESVDGKVVSSRKR 454
            .|.||:.|:...|. .|..|:|..|.:|
  Fly   414 SGISSNGSHLTASA-SSRSGRVTPSGRR 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Krt15NP_032495.2 Head 1..97
Filament 97..409 CDD:278467 112/371 (30%)
Coil 1A 98..133 16/37 (43%)
Linker 1 134..152 0/17 (0%)
Coil 1B 153..244 39/140 (28%)
Linker 12 245..264 3/25 (12%)
Coil 2 265..406 50/141 (35%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 112/371 (30%)
ATP-synt_B <67..>142 CDD:304375 18/86 (21%)
MreC <178..>224 CDD:302802 19/45 (42%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.