DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina3c and Spn42Dd

DIOPT Version :9

Sequence 1:XP_011242304.1 Gene:Serpina3c / 16625 MGIID:102848 Length:436 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:383 Identity:126/383 - (32%)
Similarity:189/383 - (49%) Gaps:31/383 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    64 LTLASINTDFAFSLYKKLALKNPDTNIVFSPLSISAALAIVSLGAKGNTLEEILEGLNFNLTETP 128
            |.:.|:....:..:|:.|:..:.:.|:|.||:||...|::|.:||:|:|.:|:...|... :|..
  Fly     8 LWVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP-SEDK 71

Mouse   129 EADIHQGFGHLLQRLSHPGEQVQISTGSALFVEKHLQILAEFQEKARALYQAEAFTADFQQPLEA 193
            || :...:|.||..|....|...:...:.::|.....:...:....|..:::||.:........|
  Fly    72 EA-VAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVA 135

Mouse   194 TKLINDYVSNQTQRKIKGLI--SDLDTDTLMVLVNYIYFKGKWKMPFNPRDTFESEFYLDVKRSV 256
            .:.||.:|.:||..||||:|  ..:.:|...:|||.|||||:|:..|:|..|..|.|.:...:||
  Fly   136 AERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSV 200

Mouse   257 KVPMM-KIKTLTTPYFRDEELSCTVVELKY-KGNASALFILPDQGRMQQVEASLQPETLRKWKNS 319
            .|.|| ::.|....||||  |...|:||.| ..|.|....||     ::||.....|  .|....
  Fly   201 PVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSALE--EKIVGF 256

Mouse   320 LRPRKMGELY--LPKFSISTDYSLKNILPELGIKEIFSKQADLSGI----TGTKDLIVSQMVHKA 378
            .||....|:|  ||||.|.....||..|.:|||:|:|:.::||||:    :|.|   |||:.|||
  Fly   257 ARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGK---VSQVSHKA 318

Mouse   379 VLDVAETGTEGVAATGVNFRILSR---RTSLWFNRTFLMVISHTDVQTTLFIAKITHP 433
            .|:|.|.|.|...||.|  .:.:|   .|.|..:..|..||  .|..|..|..::..|
  Fly   319 FLEVNEEGAEAAGATSV--AVTNRAGFSTFLMADHPFAFVI--RDANTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina3cXP_011242304.1 serpinA3_A1AC 56..434 CDD:381019 126/383 (33%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 123/370 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.