DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Klf9 and btd

DIOPT Version :9

Sequence 1:	NP_034768.2	Gene:	Klf9 / 16601	MGIID:	1333856	Length:	244	Species:	Mus musculus
Sequence 2:	NP_511100.1	Gene:	btd / 31912	FlyBaseID:	FBgn0000233	Length:	644	Species:	Drosophila melanogaster

Alignment Length:	140	Identity:	62/140 - (44%)
Similarity:	77/140 - (55%)	Gaps:	31/140 - (22%)

- Green bases have known domain annotations that are detailed below.

Mouse   103 SGSSPSHSPEERQDSGSAPSPLSLLHSGVASKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVH 167
            ||..|...|:||                        ..|:|.|...||.::|||:||||.|.|.|
  Fly   317 SGLPPIVGPDER------------------------GRKQHICHIPGCERLYGKASHLKTHLRWH 357

Mouse   168 TGERPFPCTWPDCLKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSM 232
            ||||||.|.  .|.|:|||||||.||.||||..:.:.||:|.|:|.|||||:||.:.|.:
  Fly   358 TGERPFLCL--TCGKRFSRSDELQRHGRTHTNYRPYACPICSKKFSRSDHLSKHKKTHFK----- 415

Mouse   233 IKRSKKALAS 242
            .|:|||.||:
  Fly   416 DKKSKKVLAA 425

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Klf9	NP_034768.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	26..51
		COG5048	<78..234	CDD:227381	56/130 (43%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	79..143		7/39 (18%)
		C2H2 Zn finger	145..167	CDD:275368	12/21 (57%)
		C2H2 Zn finger	175..197	CDD:275368	13/21 (62%)
		C2H2 Zn finger	205..225	CDD:275368	12/19 (63%)
btd	NP_511100.1	C2H2 Zn finger	338..357	CDD:275368	11/18 (61%)
		zf-H2C2_2	349..374	CDD:290200	16/26 (62%)
		C2H2 Zn finger	365..385	CDD:275368	13/21 (62%)
		zf-H2C2_2	377..402	CDD:290200	13/24 (54%)
		zf-C2H2	391..413	CDD:278523	12/21 (57%)
		C2H2 Zn finger	393..413	CDD:275368	12/19 (63%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910