Sequence 1: | NP_032479.1 | Gene: | Klf3 / 16599 | MGIID: | 1342773 | Length: | 344 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_722636.1 | Gene: | cbt / 33224 | FlyBaseID: | FBgn0043364 | Length: | 428 | Species: | Drosophila melanogaster |
Alignment Length: | 265 | Identity: | 81/265 - (30%) |
---|---|---|---|
Similarity: | 113/265 - (42%) | Gaps: | 81/265 - (30%) |
- Green bases have known domain annotations that are detailed below.
Mouse 81 SLKFPSHRRASPGLSMP----SSSPPIKKYSPPSPGVQPFGVPLSMPPVMAAALSRHGIRSPGIL 141
Mouse 142 PVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMDNSNSGMPVPVIESYEKPLLQKKIKIEPGIEPQR 206
Mouse 207 TDYYPEEMSPPLMNPVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYT 271
Mouse 272 KSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLAL 336
Mouse 337 HRKRH 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Klf3 | NP_032479.1 | Repressor domain | 1..74 | ||
9aaTAD, inactive. /evidence=ECO:0000250|UniProtKB:P57682 | 60..68 | ||||
CTBP-binding motif | 61..65 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 66..111 | 9/33 (27%) | |||
COG5048 | <169..>331 | CDD:227381 | 52/161 (32%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 235..254 | 0/18 (0%) | |||
C2H2 Zn finger | 261..283 | CDD:275368 | 13/21 (62%) | ||
C2H2 Zn finger | 291..313 | CDD:275368 | 13/21 (62%) | ||
zf-H2C2_2 | 305..330 | CDD:372612 | 14/24 (58%) | ||
C2H2 Zn finger | 321..341 | CDD:275368 | 10/19 (53%) | ||
cbt | NP_722636.1 | zf-C2H2 | 263..287 | CDD:278523 | 13/23 (57%) |
C2H2 Zn finger | 265..287 | CDD:275368 | 13/21 (62%) | ||
COG5048 | <270..362 | CDD:227381 | 48/76 (63%) | ||
zf-H2C2_2 | 279..306 | CDD:290200 | 16/26 (62%) | ||
C2H2 Zn finger | 295..317 | CDD:275368 | 13/21 (62%) | ||
zf-H2C2_2 | 309..332 | CDD:290200 | 13/22 (59%) | ||
zf-C2H2 | 323..345 | CDD:278523 | 12/21 (57%) | ||
C2H2 Zn finger | 325..345 | CDD:275368 | 10/19 (53%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |