DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kcnj8 and Irk3

DIOPT Version :9

Sequence 1:NP_001317292.1 Gene:Kcnj8 / 16523 MGIID:1100508 Length:424 Species:Mus musculus
Sequence 2:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster


Alignment Length:322 Identity:113/322 - (35%)
Similarity:181/322 - (56%) Gaps:12/322 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse    35 RFIAKSGACNLAHKNIREQG-RFLQDIFTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAH 98
            |.:.|:|..|:..:.|.|:. |:::|:.|||::|:|::.|.:|..|:..||||||.:.::||::|
  Fly   117 RVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYVVAYSH 181

Mouse    99 GDIYAYMEKGTMEKSGLESAVCVTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQN 163
            ||.......|.....|::.  |:..|.|:.:..::|:|.|.|:|||.:..:||||..|.:.::|.
  Fly   182 GDFIFDPVSGKRMGEGVDP--CIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFVMQM 244

Mouse   164 IVGLIINAVMLGCIFMKTAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQ 228
            :...:|...|:..|:.|||:..|:...|.||..|||..|:|:||.:|||.|.|:...|.:.:|:.
  Fly   245 LSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKIRVY 309

Mouse   229 VVKKTTTPEGEVVPIHQQDIPVDNPIESNNIFLVA-PLIICHVIDKRSPLYDISATDLAN-QDLE 291
            ::....|.|||.:..|     |:..:|.|...::. |.::|||||:.|||...:...|.| ...|
  Fly   310 IIVDKRTREGETIKSH-----VELKLEGNGEQIILWPDVVCHVIDETSPLSQFTTAKLFNAAQFE 369

Mouse   292 VIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIV--TEEEGVYSVDYSKFGNTVRVAAP 351
            :.|.:.|....|...|:|:|||:..||.||.|||:|:  ..:...|.|||..|..|:.|..|
  Fly   370 LYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISVDMP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kcnj8NP_001317292.1 IRK 37..184 CDD:366415 50/147 (34%)
Selectivity filter. /evidence=ECO:0000250 140..145 3/4 (75%)
IRK_C 191..363 CDD:375232 61/165 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..409
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 112/320 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843285
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.