DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kcnj4 and Irk3

DIOPT Version :9

Sequence 1:NP_032453.3 Gene:Kcnj4 / 16520 MGIID:104743 Length:445 Species:Mus musculus
Sequence 2:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster


Alignment Length:330 Identity:120/330 - (36%)
Similarity:183/330 - (55%) Gaps:16/330 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 RKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSWLFFGLLFWC 79
            |:..||.::|||:.||.|..:..||.|||.|:.||.::..|:|||.:|..::.:|||.|..|.:.
  Fly   112 RRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYV 176

Mouse    80 IAFFHGDLEASPSVPAAGGPGGNGGASPNAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEE 144
            :|:.|||....   |.:|...|.|      ..|||..|:.::...::|||||||:|:|.:..:||
  Fly   177 VAYSHGDFIFD---PVSGKRMGEG------VDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEE 232

Mouse   145 CPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLR 209
            ||..:...|:|.:...:|:..|:..|.||.|||.::...|.||..|||..|||:|||::||.:.|
  Fly   233 CPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPR 297

Mouse   210 KSHIVEAHVRAQLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMG 274
            :...:|:.:|..:|....|:|||.:. ...:|.:.   |.....::.|.::.|.|||.|||....
  Fly   298 EQQSIESKIRVYIIVDKRTREGETIK-SHVELKLE---GNGEQIILWPDVVCHVIDETSPLSQFT 358

Mouse   275 KEEL-ESEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVF--EEKSHYKVDYSRFH 336
            ..:| .:..||:.|.:.|...|||..|:|::|||..||.||.||..::.  .:...|.|||..|:
  Fly   359 TAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFN 423

Mouse   337 KTYEV 341
            :|..|
  Fly   424 RTISV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kcnj4NP_032453.3 IRK 22..177 CDD:366415 57/154 (37%)
Selectivity filter. /evidence=ECO:0000250 133..138 2/4 (50%)
IRK_C 184..356 CDD:375232 58/161 (36%)
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 117/323 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.