DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kcnab3 and CG18547

DIOPT Version :9

Sequence 1:NP_034729.3 Gene:Kcnab3 / 16499 MGIID:1336208 Length:404 Species:Mus musculus
Sequence 2:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster


Alignment Length:319 Identity:80/319 - (25%)
Similarity:140/319 - (43%) Gaps:50/319 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    78 MKYRNLGKSGLRVSCLGLG---TWVTFGSQISDETAEDLLTV--AYEHGVNLFDTAEVYAAGKAE 137
            |:||||||:||:||.:..|   ....:|..:.    |.:.||  |.:.|:|..|||..|..|::|
  Fly    22 MEYRNLGKTGLQVSKVSFGGGALCANYGFDLE----EGIKTVHEAVKSGINYIDTAPWYGQGRSE 82

Mouse   138 RTLGNILKSKGWRRSSYVITTKIFWGGQAETER----GLSRKHIIEGLQGSLDRLQLEYVDIV-- 196
            ..||..||..  .|.||.|.||:   .:.|.:.    ..|.|...|.::.||..|.|:|||::  
  Fly    83 EVLGLALKDV--PRESYYIATKV---ARYELDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQI 142

Mouse   197 ----FANRSDPNSPMEEIVRAMTYVINQGLALYWGTSRWSAAEIMEAYSMARQFNLIPPVCEQAE 257
                ||  .|.:..:.|.:..:..::.:|.|.:.|.|.:..:.:.|  .:.|....:..|...| 
  Fly   143 HDIEFA--KDLDIVINETLPTLEQLVKEGKARFIGVSAYPISVLKE--FLTRTAGRLDTVLTYA- 202

Mouse   258 NHFFQREKVEMQLPELYHKIGVGSVTWSPLACGLITSKYDGRVPDTCKATVKGYQWLKEKVQSEE 322
             .:...::..::..:.:....:|.:..:..|.||:|:.  |..|           |   ...|:|
  Fly   203 -RYTLTDETLLEYLDFFKSQNLGVICAAAHALGLLTNA--GPQP-----------W---HPASDE 250

Mouse   323 GKKQQARVMDLLPTARQLGCTVAQLAIAWCLRS-EGVSSVLLGVSSAEQLMEHLGSLQV 380
               |:|.........::.|..:.:||:.:.:.. ..||:.|.|:.:.:.|..:|.:.:|
  Fly   251 ---QKAIARKASEVCKERGVELGKLAMYYTMSGLPEVSTFLTGMQTRQLLRINLDANEV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kcnab3NP_034729.3 Kv_beta 80..396 CDD:213602 79/317 (25%)
Aldo_ket_red 80..395 CDD:119408 79/317 (25%)
CG18547NP_650138.1 Tas 22..331 CDD:223739 80/319 (25%)
Aldo_ket_red 24..321 CDD:294321 79/317 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5281
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R634
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.