DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AKR1C1 and CG2767

DIOPT Version :9

Sequence 1:NP_001344.2 Gene:AKR1C1 / 1645 HGNCID:384 Length:323 Species:Homo sapiens
Sequence 2:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster


Alignment Length:333 Identity:127/333 - (38%)
Similarity:202/333 - (60%) Gaps:17/333 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAI 65
            :::|:  :..|:|..|||:|.||:..::.....|::|   |:|||:||||:|.:|.||:.:|..:
  Fly     2 VNTKF--LTFNNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVL 61

Human    66 RSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIP 130
            :..:..|.||||::|..:|:...|:||..|.|.:::||::||||||||||:|.|.::...|:...
  Fly    62 KRWLDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSF 126

Human   131 K-DENGKILFD-TVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVEC 193
            | |:.|.:..| |.:..|.|.|:|...:.||.||||||||::.|:..:|.  ..|.:|..||:|.
  Fly   127 KLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEH 189

Human   194 HPYFNQRKLLDFCKSKDIVLVAYSALGS-----HREEPWVDPNSPVLLEDPVLCALAKKHKRTPA 253
            |.|..||.|:|||||::|.:.|||.|||     ......:..:.|.|::.|.:..:|..|.:|||
  Fly   190 HVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPA 254

Human   254 LIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAG---PP 315
            .:.||:.:..||..:.||.|..|::||:.||:|:||:||:..:..|::|:|......|.|   .|
  Fly   255 QVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHP 319

Human   316 NYPFSDEY 323
            .:.|.::|
  Fly   320 EFTFKNQY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AKR1C1NP_001344.2 AKR_AKR1C1-35 6..308 CDD:381334 121/308 (39%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 120/303 (40%)
Tas 10..297 CDD:223739 118/291 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.