DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WFDC13 and CG5639

DIOPT Version :10

Sequence 1:NP_742002.1 Gene:WFDC13 / 164237 HGNCID:16131 Length:93 Species:Homo sapiens
Sequence 2:NP_651570.1 Gene:CG5639 / 43314 FlyBaseID:FBgn0039527 Length:1511 Species:Drosophila melanogaster


Alignment Length:78 Identity:22/78 - (28%)
Similarity:33/78 - (42%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    20 VPGSPKQRVLKYILEPPPCISAPENCTHLCTMQEDCEKGFQCCSSFCGIVCSSETF----QKRNR 80
            :|..|.|  ..|::.|.|.......|.:.|.....|:...:|||:.||..|.....    |....
  Fly   779 LPRKPGQ--CPYLVPPGPDNLDANTCAYECRTDAHCDGARRCCSNGCGTQCVDPQLKTACQHLQA 841

Human    81 IK-HKGSEVIMPA 92
            |: |:.||:.:||
  Fly   842 IQLHQSSELGIPA 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WFDC13NP_742002.1 WFDC domain 38..70 8/31 (26%)
CG5639NP_651570.1 TY 38..101 CDD:238114
WAP 232..281 CDD:459672
TY 286..353 CDD:238114
Antistasin 373..398 CDD:460713
WAP 782..830 CDD:459672 14/49 (29%)
TY 836..903 CDD:238114 7/19 (37%)
Antistasin 911..936 CDD:460713
Thyroglobulin_1 1090..1184 CDD:459665
TY <1281..1326 CDD:238114
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.