Sequence 1: | NP_981957.1 | Gene: | UBL4B / 164153 | HGNCID: | 32309 | Length: | 174 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001284937.1 | Gene: | Ubi-p5E / 326237 | FlyBaseID: | FBgn0086558 | Length: | 534 | Species: | Drosophila melanogaster |
Alignment Length: | 208 | Identity: | 48/208 - (23%) |
---|---|---|---|
Similarity: | 86/208 - (41%) | Gaps: | 50/208 - (24%) |
- Green bases have known domain annotations that are detailed below.
Human 1 MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNA 65
Human 66 SINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQDAKAVLQLLRQEHE------ERL-- 122
Human 123 QKISLEHLEQLAQYLLAEEP--------------------------HVEPAGERELEAKARPQSS 161
Human 162 CDMEEKEEAAADQ 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
UBL4B | NP_981957.1 | UBQ | 1..74 | CDD:320785 | 22/72 (31%) |
FlhF | 20..>154 | CDD:332151 | 35/167 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 141..174 | 9/58 (16%) | |||
Ubi-p5E | NP_001284937.1 | Ubiquitin | 1..76 | CDD:176398 | 23/80 (29%) |
UBQ | 1..72 | CDD:214563 | 22/70 (31%) | ||
Ubiquitin | 77..152 | CDD:176398 | 15/77 (19%) | ||
UBQ | 77..148 | CDD:214563 | 15/73 (21%) | ||
Ubiquitin | 153..228 | CDD:176398 | 10/47 (21%) | ||
UBQ | 153..224 | CDD:214563 | 10/47 (21%) | ||
Ubiquitin | 229..304 | CDD:176398 | |||
UBQ | 229..300 | CDD:214563 | |||
Ubiquitin | 305..380 | CDD:176398 | |||
UBQ | 305..376 | CDD:214563 | |||
Ubiquitin | 381..456 | CDD:176398 | |||
UBQ | 381..452 | CDD:214563 | |||
Ubiquitin | 457..532 | CDD:176398 | |||
UBQ | 457..528 | CDD:214563 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5272 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |