DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCX and CaMKI

DIOPT Version :9

Sequence 1:NP_000546.2 Gene:DCX / 1641 HGNCID:2714 Length:441 Species:Homo sapiens
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:148 Identity:28/148 - (18%)
Similarity:54/148 - (36%) Gaps:45/148 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    17 LPKLEMLTLGSSFCSLQG----------EFCQAMD--SFTTVSHVGMC------EETDASF--NV 61
            |.|:|...:.::.|...|          .:.:|:|  |...:|::.:|      :|.||:.  .:
  Fly   192 LSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQI 256

Human    62 FSPKFQFDRSH----------------CQSLRFHQNMELDFGH--FDERDKTSRNMRGSRMNGLP 108
            ....|:||..:                |.::......:...||  ....:.:|||:.|:....|.
  Fly   257 LKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLK 321

Human   109 SPTHSAHCSFYRTRTLQA 126
            .       :|.::|..||
  Fly   322 K-------NFAKSRWKQA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCXNP_000546.2 DCX 129..219 CDD:214711
DCX 256..344 CDD:214711
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 19/108 (18%)
S_TKc 31..302 CDD:214567 19/109 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.