DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irx3 and achi

DIOPT Version :9

Sequence 1:NP_001240751.1 Gene:Irx3 / 16373 MGIID:1197522 Length:522 Species:Mus musculus
Sequence 2:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster


Alignment Length:284 Identity:70/284 - (24%)
Similarity:97/284 - (34%) Gaps:71/284 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   133 RPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR---------- 187
            |..|..:.|...||.||.|||.|.||:..||..|:....:|:.||..||.|||||          
  Fly    96 RRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREG 160

Mouse   188 -------LKKENKMTWAPRSRTDEEG-------NAYGSEREE----EDEEED-----EEESKREL 229
                   :.:..|......||:...|       .|:||...|    ..||.|     .|.....|
  Fly   161 NDPLHFTISRRGKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDGAGEIHEGIANVL 225

Mouse   230 EMEEEELAG----------EEEDT--------------GGEGLADDDEDEEID-LENLDSAAAGS 269
            ...|:.:.|          |.||:              |.:.|....:...|| ::|.....|.:
  Fly   226 TNFEQYVQGPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAA 290

Mouse   270 ELTLAGAAHRNGDFGLGPISDCKTSDSDDSSEGLEDRPLSVLSLAPPPPPVARAPASPPSPPSSL 334
               :.|:|..:|..|         ..|.:||......|.|:....||.......| .||....:.
  Fly   291 ---IGGSAVGSGGAG---------GSSSNSSPATSILPYSLFGQLPPEFDDEEKP-RPPKRVRTR 342

Mouse   335 DPCAPAPAPSSALQKPKIWSLAET 358
            ...|.:|..::...|.|..:..||
  Fly   343 TVAAKSPRENAKQAKQKTGNKQET 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irx3NP_001240751.1 Homeobox_KN 148..187 CDD:283551 19/38 (50%)
IRO 345..362 CDD:214716 4/14 (29%)
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.