DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irx2 and achi

DIOPT Version :9

Sequence 1:NP_034704.1 Gene:Irx2 / 16372 MGIID:1197526 Length:474 Species:Mus musculus
Sequence 2:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster


Alignment Length:269 Identity:66/269 - (24%)
Similarity:100/269 - (37%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse   119 RKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAP 183
            |.|..:.:...||.||.|||.|.||:..||..|:....:|:.||..||.|||||:..|       
  Fly    97 RGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPE------- 154

Mouse   184 RNKSEDEDEDEGDASRSKEESSDKAQDGTETSAEDEGIS-LHVDSLTDHSCSA--ESDGEKLPCR 245
            ..:.|..|......||..::.|......:...|...|.: .|....::....|  |.||      
  Fly   155 MIRREGNDPLHFTISRRGKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDG------ 213

Mouse   246 AGDALCESGSECKDKFED---------LEDEEDEEDECERDLAPPKPVTSSPL------TGVEAP 295
            ||: :.|..:.....||.         ::.|.:.||..  ..:..:.:.::|:      :.::|.
  Fly   214 AGE-IHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSV--IYSWQQAIANNPMGFQSLHSSLQAT 275

Mouse   296 LLSPAP-----EAAPRG----GSGGKTPLGSRTSP----------GAPPP----ASKPKLWSLAE 337
            ::....     :||..|    ||||.....|.:||          |..||    ..||:......
  Fly   276 MIDKIKNYQMRKAAAIGGSAVGSGGAGGSSSNSSPATSILPYSLFGQLPPEFDDEEKPRPPKRVR 340

Mouse   338 IATSDLKQP 346
            ..|...|.|
  Fly   341 TRTVAAKSP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irx2NP_034704.1 COG5576 <115..217 CDD:227863 31/97 (32%)
Homeobox_KN 133..172 CDD:368670 19/38 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..220 6/42 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..373 24/123 (20%)
IRO 325..342 CDD:214716 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..461
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 19/38 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.