DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACE and Ance

DIOPT Version :9

Sequence 1:NP_000780.1 Gene:ACE / 1636 HGNCID:2707 Length:1306 Species:Homo sapiens
Sequence 2:NP_001285915.1 Gene:Ance / 34805 FlyBaseID:FBgn0012037 Length:615 Species:Drosophila melanogaster


Alignment Length:593 Identity:265/593 - (44%)
Similarity:364/593 - (61%) Gaps:9/593 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   642 LVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARK 706
            ||.:|.:|.:::|..::......|...||.|.|.:|||.|..|...:.:.::|....:..:...|
  Fly    18 LVKEEIQAKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTK 82

Human   707 FDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGS--C-LQLEP 768
            |.....|:..:||..|.:..|..||||..:..|....|..||:.::...||....|  | |.|:|
  Fly    83 FQWRSYQSEDLKRQFKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVCDYKDSTKCDLALDP 147

Human   769 DLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPS 833
            ::..|::.||.:|:|.:.|..:.||||.|:...:.:||||..:||:||.:....::|...||..:
  Fly   148 EIEEVISKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNNFTSGAEAWLDEYEDDT 212

Human   834 LEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPF 898
            .||.||.:|.:::|||..:|.|||..|.:|||...::..||||.|||||||||.||.|.|:|.||
  Fly   213 FEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPMHLLGNMWAQQWSEIADIVSPF 277

Human   899 PSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWD 963
            |..|.:|.:..|.|||:||.:||:..||||||:.|..:|.:||:||::|||||||::||||||||
  Fly   278 PEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLPQDFWDKSIIEKPTDGRDLVCHASAWD 342

Human   964 FYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVST 1028
            ||...|.||||||.|..:.|...|||:||||||:||:..|...|.|||||||||:||||:|||||
  Fly   343 FYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFLQYQHQPFVYRTGANPGFHEAVGDVLSLSVST 407

Human  1029 PKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSL 1093
            ||||..:.||......||..||.|...|||||.|:||::.:|::||.:|.|.:.|.|:|..:|.|
  Fly   408 PKHLEKIGLLKDYVRDDEARINQLFLTALDKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKL 472

Human  1094 RLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTG------PL 1152
            |.:|.|:.|||.|::.|||..||:||.:.|.|:||.|||||||||:::.|..||...      ||
  Fly   473 RDEYSGIEPPVVRSEKDFDAPAKYHISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPL 537

Human  1153 HKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGE 1217
            ..||||.|..||......:.:|.|:|||:|::...|:..||..|:..||:||..||..||..:..
  Fly   538 DNCDIYGSAAAGAAFHNMLSMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKNNV 602

Human  1218 KLGWPQYN 1225
            .:||...|
  Fly   603 HIGWTTSN 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACENP_000780.1 Peptidase M2 1 30..630
Peptidase_M2 40..623 CDD:279709
Peptidase M2 2 631..1232 265/593 (45%)
Peptidase_M2 643..1221 CDD:279709 261/586 (45%)
AnceNP_001285915.1 Peptidase_M2 19..606 CDD:279709 261/586 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 529 1.000 Domainoid score I284
eggNOG 1 0.900 - - E1_KOG3690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5260
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D266227at33208
OrthoFinder 1 1.000 - - FOG0000442
OrthoInspector 1 1.000 - - otm40361
orthoMCL 1 0.900 - - OOG6_101615
Panther 1 1.100 - - O PTHR10514
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2384
SonicParanoid 1 1.000 - - X1436
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.