DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCN and CG18095

DIOPT Version :9

Sequence 1:NP_001911.1 Gene:DCN / 1634 HGNCID:2705 Length:359 Species:Homo sapiens
Sequence 2:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster


Alignment Length:280 Identity:69/280 - (24%)
Similarity:124/280 - (44%) Gaps:59/280 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    86 LDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELP----E 146
            |:||::.::::.|.....|..|..|.|.:|.:|.:...:..||..|..|.||.|.|.:|.    |
  Fly    68 LELQHSGLSDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSHNMLSKLSVKSFE 132

Human   147 KMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYI------ 205
            :.|: ||:|....|.|:::...:|:||:.:..:.|..|.|  :.|:...|:|:.:||.:      
  Fly   133 QYPQ-LQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQL--AHIDGSFFRGLHRLSSLSLQHNR 194

Human   206 -------------------------------------RIADTNITS-IPQGLPP-------SLTE 225
                                                 |:...|::| :.|.|.|       .|.:
  Fly   195 IEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSSNLLQKLEPFVFSKNFELQD 259

Human   226 LHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAE 290
            |.|..|.|::::..:|.||::|.:|.:|.|.:..:.:.||.:...|.:|.:..|.||.:|..|..
  Fly   260 LDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLIALLQLDISFNLLTTLPDNLFH 324

Human   291 -HKYIQVVYLHNNNISVVGS 309
             :..::.:.|.||.|..:.|
  Fly   325 FNTQLEEIILANNKIEEISS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCNNP_001911.1 LRRNT 54..80 CDD:279764
leucine-rich repeat 62..82 CDD:275380
NEL <70..>298 CDD:330839 64/267 (24%)
LRR 1 73..93 3/6 (50%)
leucine-rich repeat 83..106 CDD:275380 5/19 (26%)
LRR 2 94..117 6/22 (27%)
leucine-rich repeat 107..130 CDD:275380 7/22 (32%)
LRR 3 118..141 8/22 (36%)
leucine-rich repeat 131..151 CDD:275380 9/23 (39%)
LRR 4 142..162 7/23 (30%)
leucine-rich repeat 152..175 CDD:275380 8/22 (36%)
LRR 5 163..186 5/22 (23%)
leucine-rich repeat 176..201 CDD:275380 6/24 (25%)
LRR 6 187..212 6/67 (9%)
leucine-rich repeat 202..222 CDD:275380 8/70 (11%)
LRR 7 213..233 8/27 (30%)
leucine-rich repeat 223..246 CDD:275380 8/22 (36%)
LRR 8 234..257 7/22 (32%)
leucine-rich repeat 247..270 CDD:275380 6/22 (27%)
LRR 9 258..281 5/22 (23%)
LRR 10 282..304 6/22 (27%)
leucine-rich repeat 294..313 CDD:275380 5/16 (31%)
LRR 11 305..334 1/5 (20%)
LRR 12 335..359
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566 17/54 (31%)
leucine-rich repeat 65..88 CDD:275380 5/19 (26%)
leucine-rich repeat 89..112 CDD:275380 7/22 (32%)
leucine-rich repeat 113..136 CDD:275380 8/22 (36%)
LRR_RI 115..384 CDD:238064 56/233 (24%)
LRR_8 135..195 CDD:290566 17/62 (27%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 6/24 (25%)
LRR_8 184..243 CDD:290566 5/58 (9%)
leucine-rich repeat 185..208 CDD:275380 2/22 (9%)
leucine-rich repeat 209..232 CDD:275380 0/22 (0%)
LRR_8 232..289 CDD:290566 17/56 (30%)
leucine-rich repeat 233..256 CDD:275380 5/22 (23%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
LRR_8 280..339 CDD:290566 16/58 (28%)
leucine-rich repeat 281..304 CDD:275380 6/22 (27%)
leucine-rich repeat 305..328 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.