DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBP6 and atl

DIOPT Version :9

Sequence 1:NP_940862.2 Gene:GBP6 / 163351 HGNCID:25395 Length:633 Species:Homo sapiens
Sequence 2:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster


Alignment Length:416 Identity:97/416 - (23%)
Similarity:165/416 - (39%) Gaps:77/416 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    14 VENNNEQ--LLVNQQAI-QIL---EKISQPVVVVAIVGLYRTGKSYLMNH--------------- 57
            |.|.:|:  .::|:.|: ::|   |...:.|.||::.|.:|.|||:|::.               
  Fly     8 VINASEEHTFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDAT 72

Human    58 --LAGQN---HGFPLGSTVQSETKGIWMW----CVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDS 113
              |.|::   .||......:.:|.||.||    ...:|:.....::||||:|..| .:...::.:
  Fly    73 DWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFD-SQSTVRDCA 136

Human   114 WIFALAVLLCSTFVYNSMSTINHQALEQLHYVTELTELIKAKSSPRPDGVEDSTEFVSFFPDFLW 178
            .:|||:.:|.|..:||....|....|:.|...||...|..|.:..:|            |....:
  Fly   137 TVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGKKP------------FQRLQF 189

Human   179 TVRDFTLELKLNGHPITEDEYLENALKLIQGNNPRVQTSNFPRECIRRFFPKRKCFVFDRP---- 239
            .|||::...:.....:..|:.|:..|::....:|.:|:.   |..|...|.:..||:...|    
  Fly   190 LVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSL---RRHISSCFTEVACFLMPHPGLNV 251

Human   240 -TNDK------DLLANIEKVSEKQLDPKFQEQTNIFCSYIFTHARTKTLREGITVTGNRLGTLAV 297
             ||.|      |:.... |.|.:.|.|......|:....|          .|..|....|.....
  Fly   252 ATNPKFDGRLQDITPEF-KSSLRSLVPMLLAPDNLVYKEI----------SGQRVRARDLIQYFQ 305

Human   298 TYVEAINSGAVPCLENAVITLAQRENSAAVQRAADYYSQQMAQ-----RVKLPTDTLQELLDMHA 357
            :|:.......:|..::.::..|:..:..||..|.:.|.|.|.:     |..|.|..||   ..|.
  Fly   306 SYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQ---TEHL 367

Human   358 ACEREAIAIFMEHSFKDENQEFQKKF 383
            ..:.:|:..|.... |...:||.:||
  Fly   368 RVKDKALFQFAAKR-KMGGEEFTEKF 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBP6NP_940862.2 GTPase domain (Globular). /evidence=ECO:0000250 1..310 76/336 (23%)
GBP 18..281 CDD:280433 70/303 (23%)
GBP_C 283..579 CDD:202427 25/106 (24%)
GBP_C 289..579 CDD:293879 23/100 (23%)
coiled coil 548..559 CDD:293879
coiled coil 568..579 CDD:293879
atlNP_001287506.1 GBP 14..289 CDD:280433 68/291 (23%)
MSC <316..>471 CDD:286487 21/81 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142066
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.