DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ins1 and Ilp5

DIOPT Version :9

Sequence 1:NP_032412.3 Gene:Ins1 / 16333 MGIID:96572 Length:108 Species:Mus musculus
Sequence 2:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster


Alignment Length:108 Identity:29/108 - (26%)
Similarity:43/108 - (39%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LLVHFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGF--FYTPKSRREVEDPQVEQ 65
            :|:..:|||.        ..||......|||.|::.|.:.| ..||  .:..:....:.|.:...
  Fly     9 VLLFLIPLLL--------SAQAANSLRACGPALMDMLRVAC-PNGFNSMFAKRGTLGLFDYEDHL 64

Mouse    66 LELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN 108
            .:|..|..........:.|..||:||.||...||...|..||:
  Fly    65 ADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ins1NP_032412.3 IlGF_insulin_like 26..108 CDD:239833 22/83 (27%)
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.