DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ins1 and Ilp5

DIOPT Version :10

Sequence 1:NP_032412.3 Gene:Ins1 / 16333 MGIID:96572 Length:108 Species:Mus musculus
Sequence 2:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster


Alignment Length:108 Identity:29/108 - (26%)
Similarity:43/108 - (39%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 LLVHFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGF--FYTPKSRREVEDPQVEQ 65
            :|:..:|||.        ..||......|||.|::.|.:.| ..||  .:..:....:.|.:...
  Fly     9 VLLFLIPLLL--------SAQAANSLRACGPALMDMLRVAC-PNGFNSMFAKRGTLGLFDYEDHL 64

Mouse    66 LELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN 108
            .:|..|..........:.|..||:||.||...||...|..||:
  Fly    65 ADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ins1NP_032412.3 IlGF_insulin_like 26..108 CDD:239833 22/83 (27%)
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 21/77 (27%)

Return to query results.
Submit another query.