DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inhbe and scw

DIOPT Version :9

Sequence 1:NP_032408.2 Gene:Inhbe / 16326 MGIID:109269 Length:350 Species:Mus musculus
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:323 Identity:75/323 - (23%)
Similarity:122/323 - (37%) Gaps:82/323 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    55 LHLTSRPRITRPLP-QAALTRALRRL--QPKSMVPGNREKVISFATIID-------------KST 103
            :|:|..   |..:| ..:|.:|:.|:  || |:|.......:|....:|             .:|
  Fly   131 MHITFN---TNDVPVDLSLVQAMLRIYKQP-SLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTT 191

Mouse   104 STYRSMLTFQLSPLWSHHLYHARLWLHVPPSFPGTLYLRIFRCGTTRCRGFRTFLAEHQ--TTSS 166
            |:.|..|.|.|:..       .|.|||              ..|..|....|..:.:.|  |.::
  Fly   192 SSQRGWLEFNLTDT-------LRYWLH--------------NKGLQRRNELRISIGDSQLSTFAA 235

Mouse   167 GWHALTLPSSGLRSEDSGVVKLQLEFRPLDLNSTAAGLPRLLLDTAGQQRPFLELKIRANEPGAG 231
            |   |..|.:...|.:..:|..        .|.     |.||:..   |:...:..:.....|.|
  Fly   236 G---LVTPQASRTSLEPFIVGY--------FNG-----PELLVKI---QKLRFKRDLEKRRAGGG 281

Mouse   232 RARRRTPTCEPETPL--------CCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSP 288
                 :|...|..|:        |.|.:..|||:||...:|::.|:.::..:|.|.|...|... 
  Fly   282 -----SPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTK- 340

Mouse   289 GIAASFHSAVFSLLKANNPWPAGSSCCVPTARRPLSLL-YLDHNGNVVK-TDVPDMVVEACGC 349
             :.|:.|:.|.:|:....| .....|||||....:::| ||  |.:::. |.....|.:.|||
  Fly   341 -MNATNHAIVQTLMHLKQP-HLPKPCCVPTVLGAITILRYL--NEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
InhbeNP_032408.2 TGF_beta 246..349 CDD:278448 30/112 (27%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 33/150 (22%)
TGFB 300..400 CDD:214556 32/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.