DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DENND2C and CG18659

DIOPT Version :9

Sequence 1:NP_001243333.1 Gene:DENND2C / 163259 HGNCID:24748 Length:928 Species:Homo sapiens
Sequence 2:NP_665880.2 Gene:CG18659 / 35929 FlyBaseID:FBgn0027561 Length:908 Species:Drosophila melanogaster


Alignment Length:452 Identity:126/452 - (27%)
Similarity:204/452 - (45%) Gaps:60/452 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   488 QQLFELFVVVS----LQKKPSGISYIPQV-----IQQFPGKDDHGYKQSKDMEERLKVIPKFCFP 543
            ::|||.:..|:    |::..|..|..|.|     ::.||    .|::.    :|.|..||.|.||
  Fly    10 KKLFEFWCEVTPTPGLERGTSSRSGGPAVPAGVIVESFP----EGFRD----QEVLTGIPSFAFP 66

Human   544 DSKDWMPTSELKSETFSFVLTGEDGSRW-FGYCKKLLPVGKGKRLPEVYCMVSRLGCFNLFSKIL 607
                 ..|:....:|:|||.|..| |:| ||:|:      :..|......:::.|...:.|.|:|
  Fly    67 -----CDTTSTSVQTYSFVHTTGD-SKWRFGFCR------QDPRTNTAMVLITYLPWHDTFLKLL 119

Human   608 DEVEKRREMSPALVYPFMRSVMEAPFPAPGRTITVKSYLPGAGDESIELCRPLDSRL----EHVD 668
            ..:.:.|...|.....|:........|..|.::  |.|. .||.......|||..:|    |:.:
  Fly   120 PVLAELRRTDPNGFRTFLSEAYNQGIPDCGGSL--KVYY-SAGQSHFTFERPLQFQLPSMPENHN 181

Human   669 FKCLFKCLSVCHLIRVCASLLLERRVIFVANSLSTLSKCGHAVVATLYPFTWQHTYIPVLPASMI 733
            ....:..:....:|.|.|::|.|||:||.:..|..||.|..|..|.|||..|||.:|||||....
  Fly   182 LNLYYNFVEPKEMIAVFAAMLAERRIIFTSRHLDRLSSCIQAANAFLYPMVWQHIFIPVLPWEFK 246

Human   734 DIVCSPTPFLIGILSCSLPQLQDLPIEEVLIVDLCADKFLQEVSDEDEILPPKLQAALMQILEER 798
            |.:.:|.|:|||:....|..:....:.||:|:: |..|..:...|:...||.::.:.|.:.|   
  Fly   247 DYLGAPMPYLIGVPEPVLETVTSDELGEVVILN-CDTKIFESPFDDVHNLPTEIVSQLKKHL--- 307

Human   799 NEILTQEQNFSQDVTLNSLVSEAFVRFFVELVGHYSLNMTVTERGERVFQREPFRKSHTSRSVRH 863
                    |.:.| .:...:|:.|:...|:|:|.|. :........:.|..:.|.:|..:. :|.
  Fly   308 --------NHTHD-HIGDRISKIFLNALVQLIGGYR-DAVEYHENSKTFNSQKFIESRPAH-LRP 361

Human   864 FLDLFMETQMFAGFIQDR-ELRKSGV--KGLFEIRAIQYLETIPESEPSGMN-RILRSLGSK 921
            ||...|:.|:||.||.|| .:..||:  ...||:..::|    .|.:..|.| .|:::|..|
  Fly   362 FLAKMMDLQIFAQFIDDRLTMLNSGLGFSDEFELETVRY----AEKKKRGRNYAIMKNLKDK 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DENND2CNP_001243333.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..105
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..266
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..456
uDENN 487..576 CDD:214824 30/97 (31%)
DENN 586..770 CDD:280329 56/187 (30%)
dDENN 815..881 CDD:129037 18/65 (28%)
CG18659NP_665880.2 uDENN 10..95 CDD:214824 31/104 (30%)
DENN 98..282 CDD:280329 56/187 (30%)
dDENN 315..379 CDD:129037 18/65 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3569
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.