DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DENND2C and rme-4

DIOPT Version :9

Sequence 1:NP_001243333.1 Gene:DENND2C / 163259 HGNCID:24748 Length:928 Species:Homo sapiens
Sequence 2:NP_001359519.1 Gene:rme-4 / 185870 WormBaseID:WBGene00004375 Length:663 Species:Caenorhabditis elegans


Alignment Length:426 Identity:112/426 - (26%)
Similarity:174/426 - (40%) Gaps:90/426 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   534 LKVIPKFCFPDSKDWMPTSELKS------ETFSFVLTGEDGSRWFGYCKKLLPVGKGKRLPEVYC 592
            :|.:.:|.||        .:|:.      :.||||||..:....||:|:..      .|.....|
 Worm    46 VKSVQQFAFP--------CQLREVEVDAVQLFSFVLTDSNSKFSFGFCR
YT------PRTDTCIC 96

Human   593 MVSRLGCFNLFSKILDEV-----EKRREMSPALVYPFMRSVMEAP-------FPAPGRT------ 639
            .:|.....|:|.|.|:::     ..:||...:::..|..:  :.|       |....:|      
 Worm    97 FLSGFFWPNVFFKALNDISLVIGSAQREDVESVLTKFYHT--DIPNIDEYLRFADSNQTDGHNYR 159

Human   640 ------ITVKSYLPGAGDES--IELCRPLDSRLEHVDFKCLFKCLSVCHLIRVCASLLLERRVIF 696
                  |...:.||..|.:.  :|....:|.|                .::.:.||||.|||::|
 Worm   160 VVFAEKIPDHTRLPTLGSDKFFLEFYNAIDPR----------------QMLAIFASLLKERRILF 208

Human   697 VANSLSTLSKCGHAVVATLYPFTWQHTYIPVLPASMIDIVCSPTPFLIGILSCSL--PQLQDLPI 759
            ....:.:||.|.|||...|||..||..:|.:||.|::|:|.:|.|:|||:....|  .:|....|
 Worm   209 TGRKVGSLSSCLHAVSMLLYPMCWQSVFITILPESLVDMVMAPMPYLIGVPKTVLENARLNIRDI 273

Human   760 EEVLIVDLCADKFLQEVSDEDEILPPKLQAALMQILEERNEILTQEQNFSQDVTLNSLVSEAFVR 824
            .||:|||: .:|.|....|:...:|.::...|...|..::             .::...::.|:|
 Worm   274 GEVVIVDI-D
EKTLTSPFDDVAAMPQEVVNFLKAQLRSQS-------------AMDDTFAKHFLR 324

Human   825 FFVELVGHYSLNMTVTERGERVFQREPF---RKSHTSRSVRHFLDLFMETQMFAGFIQDR-ELRK 885
            ..|.|.|.|:...|.......||.:|.|   :|......|...|.. ...|....||.|| ||.|
 Worm   325 AMVMLFGDYTSGFTGDTPETLVFSKERFVVQQKPSYQAYVSSLLGA-DGVQYLERFIHDRLELYK 388

Human   886 SG-VKG-LFEIRAIQY-LETIPESEPSGMNRILRSL 918
            .| |.| .|||...|. |:..|..|  ..|.::.:|
 Worm   389 DGHVPGDQFEIEIEQMDLKNRPVKE--NANDVIGAL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DENND2CNP_001243333.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..105
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..266
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..456
uDENN 487..576 CDD:214824 13/47 (28%)
DENN 586..770 CDD:280329 58/211 (27%)
dDENN 815..881 CDD:129037 17/68 (25%)
rme-4NP_001359519.1 uDENN 12..86 CDD:214824 13/47 (28%)
DENN 91..282 CDD:214823 57/209 (27%)
dDENN 315..383 CDD:129037 17/68 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.