DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inhbc and scw

DIOPT Version :9

Sequence 1:NP_034695.1 Gene:Inhbc / 16325 MGIID:105932 Length:352 Species:Mus musculus
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:435 Identity:92/435 - (21%)
Similarity:146/435 - (33%) Gaps:125/435 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 LLALLFLT-------PTTVVNPKTEGPCPACWGAIFD---LESQREL--LLDLAKKSILDKLHLS 58
            :|.:.|||       .||.|........|     |:.   |..|.|:  :|||.     |:....
  Fly     1 MLNVFFLTSLFYAASATTYVTTNNHIEMP-----IYQKRPLSEQMEMIDILDLG-----DRPRRQ 55

Mouse    59 QRPILSRPVSRGALKTALQRLRGPRRETLLEHDQRQEEYEII-----SFADTDLSSINQTRLE-- 116
            ..|.|....|:..|            |...|..:.||..|::     ...|.|:...|:.|.|  
  Fly    56 AEPNLHNSASKFLL------------EVYNEISEDQEPKEVLHQRHKRSLDDDILISNEDRQEIA 108

Mouse   117 -----FHFSGRMAS--------------------GMEVRQTRFMFFVQFPHNATQTMNIRVLVLR 156
                 ..||.|:..                    .:.:.|.....:.| |....:..|..|.|.|
  Fly   109 SCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQ-PSLVDRRANFTVSVYR 172

Mouse   157 PYDTNLTLTSQYVVQVNAS----GWYQ-----------------------LLLGPEAQAACSQGH 194
            ..|.....:.:.:..||.:    ||.:                       :.:|....:..:.|.
  Fly   173 KLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIGDSQLSTFAAGL 237

Mouse   195 LTLELVPESQVAHSSL---ILGWFSHRPFVA--AQVRVEGKHRVRRRG-----------IDCQGA 243
            :|      .|.:.:||   |:|:|:....:.  .::|.:.....||.|           :|....
  Fly   238 VT------PQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRP 296

Mouse   244 SRMCCRQEFFVDFREIGWNDWIIQPEGYAMNFCTGQC--PLHVAGMPGISASFHTAVLNLLKANA 306
            .:.|.|..|.|||:|:..::|:|.|:.:...||.|.|  ||...    ::|:.|..|..|:....
  Fly   297 PQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTK----MNATNHAIVQTLMHLKQ 357

Mouse   307 AAGTTGRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGC 351
            .....   .|||||....:::|.|..:..|..|.....|.:.|||
  Fly   358 PHLPK---PCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
InhbcNP_034695.1 TGFB 247..352 CDD:214556 33/107 (31%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 42/238 (18%)
TGFB 300..400 CDD:214556 33/107 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.