DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCC and Dscam1

DIOPT Version :10

Sequence 1:NP_005206.2 Gene:DCC / 1630 HGNCID:2701 Length:1447 Species:Homo sapiens
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:1732 Identity:385/1732 - (22%)
Similarity:609/1732 - (35%) Gaps:505/1732 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    24 SAHLQVTGFQIKAFTALRF----LSEPSDAVTMR-GGNVLLDCSAESDRGVPVIKWKKDGIHLAL 83
            ||.|::.|         ||    :.:.....||. |.:|.|.|.| .....|.|.|:.||..:| 
  Fly   421 SAELKLGG---------RFDPPVIRQAFQEETMEPGPSVFLKCVA-GGNPTPEISWELDGKKIA- 474

Human    84 GMDERKQQLS-----NGSLL-IQNILHSRHHKPDEGLYQCEASLGDSGSIISRTAKVAVAGPLRF 142
              :..:.|:.     ||.:: ..||  :..|..|.|||:|.|.  ....:...:||:.|.| |.:
  Fly   475 --NNDRYQVGQYVTVNGDVVSYLNI--TSVHANDGGLYKCIAK--SKVGVAEHSAKLNVYG-LPY 532

Human   143 LSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDLTPIPGDSRVVVLPSGALQISRLQ-PGD 206
            :.|.|......|:|:::.|.|.|.|:.:|.|:::.:.|   |.:.:..|.|:|.|.|..:: ..|
  Fly   533 IRQMEKKAIVAGETLIVTCPVAGYPIDSIVWERDNRAL---PINRKQKVFPNGTLIIENVERNSD 594

Human   207 IGIYRCSARNPA--SSRTGNEAEVRILSD--PGLHRQLYFLQRPSNVVAIEGKDAVLECCV-SGY 266
            ...|.|.|:|..  |:|...|.:|.:|..  |..:..|..:          |....|.|.: .|.
  Fly   595 QATYTCVAKNQEGYSARGSLEVQVMVLPQIVPFAYEDLINM----------GDSIDLFCQIQKGD 649

Human   267 PPPSFTWL-------RGEEVIQLR------SKKYSLLGGSNLLISNVTDDDSGMYTCVVTYKNEN 318
            .|....|.       .|.:.:|.:      |:|.|::.     |.:.:...:|..||:.:.|...
  Fly   650 RPIKVHWSFERSAGDYGFDQVQPQMRTNRISEKTSMIS-----IPSASPAHTGRDTCIASNKAGT 709

Human   319 ISASAELTVLVPPWFLNHPSNLYAYESMDIEFECTVSGKPVPTVNWMKN-GDVVIPSDYFQIVGG 382
            .:.|.:|||.|||.::..|::....:..|.:.||...|.|.|.|.|.|. ||.  |.:|..:...
  Fly   710 TTYSVDLTVNVPPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDT--PGEYKDLKKS 772

Human   383 SNLRIL-------GVVKSDEGFYQCVAENEAGNAQTSAQLIVPKPAIP----------------- 423
            .|:|:.       .:.|::||:|.|.|.|..|:. .||.:::...|.|                 
  Fly   773 DNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSG-LSAVIMISVQAPPEFTEKLRNQTARRGEPA 836

Human   424 -----------------------------------------------------SSSVL------- 428
                                                                 |.|.|       
  Fly   837 VLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATN 901

Human   429 ----------------PSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERAL 477
                            |..|..:..:..|.|.|:|||..|.:....:..:.:.|.|...:.....
  Fly   902 AFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEID 966

Human   478 NTTQPG-SLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTSP 541
            ....|| :.:..|..|.|...|..|:||.|..|..:||:.:.:.|..|.. .|..:|::....:.
  Fly   967 RVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAP-SGKPQNIKVEPVNQ 1030

Human   542 TSILITWEPPAYA--NGPVQGYRL-----------------FCTEVSTGKEQNIEVDGLSYKLEG 587
            |::.:||:||...  ||.:.||.:                 |.||  .|||.|:|       |:.
  Fly  1031 TTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITE--EGKEHNLE-------LQN 1086

Human   588 LKKFTEYSLRFLAYNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQN 652
            |:.:|:||:...|:|:.|.|..:::....|....||.||.:.:...:.|::|:|.|:.||..:.|
  Fly  1087 LRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESAN 1151

Human   653 GFITGYKIRHRKTTRRGEMETLEPNNLWY---------------LFTGLEKGSQYSFQVSAMTVN 702
            |.|..||:            ...|::.||               :..||:|.:.|:.||.|.|..
  Fly  1152 GVIKTYKV------------VYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG 1204

Human   703 GTGPPSNWYTAETPENDLDESQVPDQPSSLHVRPQTN-CIIMSWTPPLNPNIVVRGYIIGYGVGS 766
            |.|..|      .|.:...|..||:.|:.:......| .|::||.||..||.::..|.:......
  Fly  1205 GDGVRS------VPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG 1263

Human   767 PYAE--TVRVDSKQRYYSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPL 829
            ...|  |.:|...|..:....||.:..|...:.|....|||      ..::||.  ..|.|..|.
  Fly  1264 AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEG------QQSKSIV--AMPSDQVPA 1320

Human   830 ----LDDFPTSV--PDLSTPMLPPVGVQAVALT----------HDAVRV---------------- 862
                .||..|:.  .|...|.| .||.....:|          :|.:||                
  Fly  1321 KIASFDDTFTATFKEDAKMPCL-AVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA 1384

Human   863 ----SWADNSVPKNQKTSEVRL--------YTVRWRTSFSASAKYKSE--DTTSLSYTATGLKPN 913
                ..|:||:.|:..|.::.:        .|:...|:.:.:.|.|..  ||..|.......||.
  Fly  1385 GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPE 1449

Human   914 -TMYEFSVMVTKNRRSSTWSM------TAHATTYEAAPTSAPKDLTVITREG-------KPRAVI 964
             ..:|.|.:...:::.:...:      ..:||.:.........|:.....:|       |||.:.
  Fly  1450 FGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEKPRFIE 1514

Human   965 VSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRL-------------THQIMDLNLDT 1016
            ||       :..::.:...:. |...|:..:::|:...|::             .:.::||...|
  Fly  1515 VS-------SNSVSLHFKAWK-DGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLEPAT 1571

Human  1017 MYYFRIQARNSKG--VGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPP 1079
            .|..||.|.||.|  |....    |.||.|.             .|...|:|    |.|      
  Fly  1572 WYNLRITAHNSAGFTVAEYD----FATLTVT-------------GGTIAPLD----DGS------ 1609

Human  1080 IGQMHPPHGSV---------TPQ-KNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQQRKKRA 1134
                  .||:|         .|: .:.|.:|.::.||    |:|.|.:.|:|...|     ::||
  Fly  1610 ------GHGNVHTRIRLPAWMPEWLDLNFMVPLIATV----VVVAVGICVVCVALS-----RRRA 1659

Human  1135 THSAGKRK--------------GSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQD 1185
            ....|.:|              |:..|.|.|||     ..|:..|..|:...|....|...:|..
  Fly  1660 DDMRGGQKDVYYDVVYNQTMGPGATLDKRRPDL-----RDELGYIAPPNRKLPPVPGSNYNTCDR 1719

Human  1186 LTPVSHSQSETQLGSKSTSHSGQDTEEAGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAV--- 1247
            :        :...|...::||..|                    ||           .||.:   
  Fly  1720 I--------KRGRGGLRSNHSTWD--------------------PR-----------RNPNLYEE 1745

Human  1248 VSAIPVPTLESAQYPGILPSPTCGYPHPQFTLRPVPF-------------PTLSVDRGFGAGRSQ 1299
            :.|.||| :....|.....:..|.|.||.......|:             ||.:::  |.....|
  Fly  1746 LKAPPVP-MHGNHYGHAHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMN--FQTFPHQ 1807

Human  1300 SVSEGPTT-QQPPMLPPSQPEHSSSEEAPSRTIPTACVRPTHPLRSFANPLLPP------PMSAI 1357
            :...||.. ....||||..|.|..|... |:::|.|........:...:.:..|      |.:..
  Fly  1808 NGHAGPVPGHAGTMLPPGHPGHVHSRSG-SQSMPRANRYQRKNSQGGQSSIYTPAPEYDDPANCA 1871

Human  1358 EPKV--PYTPLLSQ-------PGPTL-----------------------PKTHV-KTASLG--LA 1387
            |...  .||.:.||       |||..                       |..|. ...|:|  ..
  Fly  1872 EEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPYDHYGSRGSMGRRSI 1936

Human  1388 GKARSP--LLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSE 1427
            |.||:|  ..|...|..|...:.|:....||.   |.:::||
  Fly  1937 GSARNPGNGSPEPPPPPPRNHDMSNSSFNDSK---ESNEISE 1975

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCCNP_005206.2 IgI_1_Neogenin_like 39..136 CDD:409387 29/107 (27%)
Ig strand A 39..42 CDD:409387 0/2 (0%)
Ig strand A' 45..51 CDD:409387 0/5 (0%)
Ig strand B 55..65 CDD:409387 4/9 (44%)
Ig strand C 70..76 CDD:409387 3/5 (60%)
Ig strand C' 78..81 CDD:409387 1/2 (50%)
Ig strand D 88..93 CDD:409387 1/4 (25%)
Ig strand E 95..101 CDD:409387 1/6 (17%)
Ig strand F 113..120 CDD:409387 4/6 (67%)
Ig strand G 125..136 CDD:409387 2/10 (20%)
Ig_3 139..216 CDD:464046 22/77 (29%)
I-set 241..327 CDD:400151 18/99 (18%)
Ig strand B 257..261 CDD:409562 1/3 (33%)
Ig strand C 270..274 CDD:409562 0/3 (0%)
Ig strand E 293..297 CDD:409562 0/3 (0%)
Ig strand F 307..312 CDD:409562 2/4 (50%)
Ig strand G 322..325 CDD:409562 1/2 (50%)
Ig 334..417 CDD:472250 26/90 (29%)
Ig strand B 348..352 CDD:409388 0/3 (0%)
Ig strand C 361..365 CDD:409388 1/3 (33%)
Ig strand E 383..387 CDD:409388 1/3 (33%)
Ig strand F 397..402 CDD:409388 2/4 (50%)
Ig strand G 410..413 CDD:409388 0/2 (0%)
FN3 429..521 CDD:238020 24/92 (26%)
FN3 <478..901 CDD:442628 125/506 (25%)
FN3 946..1041 CDD:238020 23/116 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1126..1152 7/39 (18%)
Neogenin_C 1148..1445 CDD:461954 71/340 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1165..1222 9/56 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1288..1330 12/42 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1394..1419 6/24 (25%)
Interaction with MYO10. /evidence=ECO:0000269|PubMed:21642953 1432..1439
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547
Ig strand A 39..42 CDD:409547
Ig strand A' 48..52 CDD:409547
Ig strand B 55..64 CDD:409547
Ig strand C 70..76 CDD:409547
Ig strand C' 78..81 CDD:409547
Ig strand D 87..90 CDD:409547
Ig strand E 95..100 CDD:409547
Ig strand F 113..121 CDD:409547
Ig strand G 124..136 CDD:409547
IgI_2_Dscam 246..343 CDD:409545
Ig strand A 247..250 CDD:409545
Ig strand A' 260..264 CDD:409545
Ig strand B 267..274 CDD:409545
Ig strand C 282..288 CDD:409545
Ig strand C' 294..297 CDD:409545
Ig strand D 303..307 CDD:409545
Ig strand E 309..315 CDD:409545
Ig strand F 322..330 CDD:409545
Ig strand G 333..343 CDD:409545
IgC2_3_Dscam 346..426 CDD:409549 3/4 (75%)
Ig strand A 347..352 CDD:409549
Ig strand A' 355..359 CDD:409549
Ig strand B 362..372 CDD:409549
Ig strand C 377..383 CDD:409549
Ig strand C' 384..387 CDD:409549
Ig strand E 392..398 CDD:409549
Ig strand F 405..413 CDD:409549
Ig strand G 416..426 CDD:409549 3/4 (75%)
IgI_4_Dscam 432..527 CDD:409548 27/102 (26%)
Ig strand A 432..435 CDD:409548 0/2 (0%)
Ig strand A' 441..445 CDD:409548 1/3 (33%)
Ig strand B 448..457 CDD:409548 4/9 (44%)
Ig strand C 462..468 CDD:409548 3/5 (60%)
Ig strand C' 470..473 CDD:409548 1/2 (50%)
Ig strand D 478..486 CDD:409548 1/7 (14%)
Ig strand E 490..499 CDD:409548 2/10 (20%)
Ig strand F 506..514 CDD:409548 5/9 (56%)
Ig strand G 517..527 CDD:409548 2/9 (22%)
IgI_5_Dscam 531..618 CDD:409550 25/89 (28%)
Ig strand A 531..533 CDD:409550 0/1 (0%)
Ig strand A' 538..542 CDD:409550 0/3 (0%)
Ig strand B 545..552 CDD:409550 1/6 (17%)
Ig strand C 559..565 CDD:409550 2/5 (40%)
Ig strand C' 566..568 CDD:409550 0/1 (0%)
Ig strand D 575..579 CDD:409550 0/3 (0%)
Ig strand E 582..588 CDD:409550 3/5 (60%)
Ig strand F 596..604 CDD:409550 3/7 (43%)
Ig strand G 608..618 CDD:409550 3/9 (33%)
Ig 621..718 CDD:472250 21/111 (19%)
Ig strand B 639..643 CDD:409353 1/3 (33%)
Ig strand C 653..657 CDD:409353 0/3 (0%)
Ig strand E 684..688 CDD:409353 1/8 (13%)
Ig strand F 698..703 CDD:409353 2/4 (50%)
Ig strand G 711..714 CDD:409353 0/2 (0%)
IgI_7_Dscam 721..815 CDD:409546 28/96 (29%)
Ig strand A 721..725 CDD:409546 2/3 (67%)
Ig strand A' 730..734 CDD:409546 0/3 (0%)
Ig strand B 737..746 CDD:409546 3/8 (38%)
Ig strand C 752..758 CDD:409546 2/5 (40%)
Ig strand C' 764..767 CDD:409546 0/2 (0%)
Ig strand D 775..778 CDD:409546 1/2 (50%)
Ig strand E 780..786 CDD:409546 0/5 (0%)
Ig strand F 793..801 CDD:409546 4/7 (57%)
Ig strand G 806..815 CDD:409546 2/9 (22%)
Ig 818..916 CDD:472250 4/97 (4%)
Ig strand B 836..840 CDD:409353 0/3 (0%)
Ig strand C 849..853 CDD:409353 0/3 (0%)
Ig strand E 880..884 CDD:409353 0/3 (0%)
Ig strand F 894..899 CDD:409353 1/4 (25%)
FN3 <899..1212 CDD:442628 84/340 (25%)
Ig strand G 907..910 CDD:409353 0/2 (0%)
FN3 1222..1312 CDD:238020 24/97 (25%)
Ig <1339..1406 CDD:472250 13/67 (19%)
Ig strand C 1350..1354 CDD:409358 1/3 (33%)
Ig strand E 1372..1376 CDD:409358 0/3 (0%)
Ig strand F 1386..1391 CDD:409358 0/4 (0%)
Ig strand G 1399..1402 CDD:409358 0/2 (0%)
FN3 1409..1499 CDD:238020 14/89 (16%)
FN3 1504..1584 CDD:238020 18/87 (21%)
Dscam_C 1893..2008 CDD:463546 20/86 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.