DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCC and Fas2

DIOPT Version :10

Sequence 1:NP_005206.2 Gene:DCC / 1630 HGNCID:2701 Length:1447 Species:Homo sapiens
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:645 Identity:159/645 - (24%)
Similarity:265/645 - (41%) Gaps:98/645 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    20 ASLFSAHLQVTGFQIKAFTALRFLSEPSDAVTMRGGNVLLDCSAESDRGVPVIKWKKDGIHLALG 84
            ||..:..:...|..||.:.|:.:.:.|.:.....|.:.::.|..::|.. |.|.|.::|..:...
  Fly   118 ASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPN-PTIDWLRNGDPIRTT 181

Human    85 MDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEASLGDSGSIISRTAKVAVAGPLRFLSQTESV 149
            .|:...| :|| |||:|:..|     |||:|.|.|::.::|.::.||.:|.|......:|...::
  Fly   182 NDKYVVQ-TNG-LLIRNVQES-----DEGIYTCRAAVIETGELLERTIRVEVFIQPEIISLPTNL 239

Human   150 TAFMGDTVLLKCEVIGEPMPTIHWQKNQQDLTPIPGDSRVVVLPSGALQISRLQPGDIGIYRCSA 214
            .|..|......|...|:|:|.|.|.::...|.....|...|...:|.:.||.:...|.|.|.|.|
  Fly   240 EAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLA 304

Human   215 RNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFT---WLRG 276
            :|.|.. ...:.::.:|..|.:: :||      ||.....|:..:.|...|.|.|:.|   |...
  Fly   305 KNRAGV-VDQKTKLNVLVRPQIY-ELY------NVTGARTKEIAITCRAKGRPAPAITFRRWGTQ 361

Human   277 EEV----------IQLRSKKYSLLGGS--NLLISNVTDDDSGMYTCVVTYKNENISASAELTVLV 329
            ||.          |.|........|.|  .|.|||....|.|:|.|:...|..:...:..:||..
  Fly   362 EEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEF 426

Human   330 PPWFLNHPSNL---YAYESMDIEFECTVSGKPVPTVNWMKNGDVVIPSDYFQIVGGSNLRILG-- 389
            .|.| :|...|   :::|.......|...|.|..|:.|..||..:  .|.:.    :||:|:|  
  Fly   427 APDF-SHMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKI--KDLYD----TNLKIVGTG 484

Human   390 ---------VVKSDEGFYQCVAENEAGNAQTSAQLIVPKPAIPSSSVLPSAPRDVVPVLVSSRFV 445
                     |.:.....|:|:|.|..|.|:...||        ..:.:|....:..|..:::..:
  Fly   485 PRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQL--------KEARVPDFVSEAKPSQLTATTM 541

Human   446 RLSWRPPAEAKG-NIQTFTVFFSREGDNRERALN---------TTQPGSLQLTVGNLKPEAMYTF 500
            ....|.|:...| .|..::|.:       :.|||         :..|.|..:..| |:|:..|:|
  Fly   542 TFDIRGPSTELGLPILAYSVQY-------KEALNPDWSTAYNRSWSPDSPYIVEG-LRPQTEYSF 598

Human   501 RVVAYNEWGPG------ESSQPIKVATQPELQVPGPVEN--LQAVSTSPTS--ILITWEPPAYAN 555
            |..|.|:.|.|      :.|.|.:.|.:....:..||::  .:.|..||.|  ..:.|..||...
  Fly   599 RFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHFELRWGVPADNG 663

Human   556 GPVQGYRL-FCTEVS-TGKEQNIE--------VDGLSYKLEGLKKFTEYSLRFLAYNRYG 605
            .|:..|:: :|..|. :|....:|        ::..|:::..|...|.|.:...|:|..|
  Fly   664 EPIDRYQIKYCPGVKISGTWTELENSCNTVEVMETTSFEMTQLVGNTYYRIELKAHNAIG 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCCNP_005206.2 IgI_1_Neogenin_like 39..136 CDD:409387 28/96 (29%)
Ig strand A 39..42 CDD:409387 1/2 (50%)
Ig strand A' 45..51 CDD:409387 1/5 (20%)
Ig strand B 55..65 CDD:409387 1/9 (11%)
Ig strand C 70..76 CDD:409387 3/5 (60%)
Ig strand C' 78..81 CDD:409387 1/2 (50%)
Ig strand D 88..93 CDD:409387 1/4 (25%)
Ig strand E 95..101 CDD:409387 4/5 (80%)
Ig strand F 113..120 CDD:409387 3/6 (50%)
Ig strand G 125..136 CDD:409387 4/10 (40%)
Ig_3 139..216 CDD:464046 20/76 (26%)
I-set 241..327 CDD:400151 25/100 (25%)
Ig strand B 257..261 CDD:409562 0/3 (0%)
Ig strand C 270..274 CDD:409562 1/6 (17%)
Ig strand E 293..297 CDD:409562 2/5 (40%)
Ig strand F 307..312 CDD:409562 2/4 (50%)
Ig strand G 322..325 CDD:409562 0/2 (0%)
Ig 334..417 CDD:472250 24/96 (25%)
Ig strand B 348..352 CDD:409388 0/3 (0%)
Ig strand C 361..365 CDD:409388 1/3 (33%)
Ig strand E 383..387 CDD:409388 2/3 (67%)
Ig strand F 397..402 CDD:409388 2/4 (50%)
Ig strand G 410..413 CDD:409388 0/2 (0%)
FN3 429..521 CDD:238020 24/107 (22%)
FN3 <478..901 CDD:442628 38/157 (24%)
FN3 946..1041 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1126..1152
Neogenin_C 1148..1445 CDD:461954
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1165..1222
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1288..1330
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1394..1419
Interaction with MYO10. /evidence=ECO:0000269|PubMed:21642953 1432..1439
Fas2NP_001284854.1 Ig 33..121 CDD:472250 2/2 (100%)
Ig strand B 50..54 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 99..103 CDD:409353
Ig strand F 113..118 CDD:409353 159/645 (25%)
Ig 139..209 CDD:472250 22/77 (29%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 3/4 (75%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 22/90 (24%)
Ig strand A 229..232 CDD:409568 0/2 (0%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 1/3 (33%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 4/7 (57%)
Ig strand G 309..319 CDD:409568 0/10 (0%)
IG_like 330..424 CDD:214653 24/93 (26%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 2/5 (40%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 19/73 (26%)
Ig strand B 447..451 CDD:409353 0/3 (0%)
Ig strand C 460..464 CDD:409353 1/3 (33%)
Ig strand E 487..491 CDD:409353 0/3 (0%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 22/101 (22%)
FN3 640..735 CDD:238020 20/84 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.