DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCC and Dscam4

DIOPT Version :10

Sequence 1:NP_005206.2 Gene:DCC / 1630 HGNCID:2701 Length:1447 Species:Homo sapiens
Sequence 2:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster


Alignment Length:1696 Identity:369/1696 - (21%)
Similarity:607/1696 - (35%) Gaps:499/1696 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    47 SDAVTMRGGNVLLDCSAESDRGVPVIKWKKDGIHLALGMDERK----QQLSNGSLLIQNILHSRH 107
            |:.....|..|.|.|.| :...:|...|..||..:.   |..:    |.::....:|.::..|..
  Fly   429 SEQTLQPGPTVSLKCVA-TGNPLPQFTWSLDGFPIP---DSSRFLVGQYVTIHDDVISHVNISNV 489

Human   108 HKPDEGLYQCEA--SLGDSGSIISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPT 170
            .:.|.|.|.|.|  ::|.    :|.:|||.:.| |.::.:...:|...|..:::||.|.|.|:..
  Fly   490 KEEDGGEYTCTAQNAIGK----VSHSAKVNI
YG-LPYIREMPKITGISGSDLIVKCPVAGYPIDK 549

Human   171 IHWQKNQQDLTPIPGDSRVVVLPSGALQISRLQP-GDIGIYRCSARNPASSRTGNEAEVRILSDP 234
            |||:::.|.|   |.:.|.....:|.|.|.:||. .|.|.|.|.|:|.....:....|:::|..|
  Fly   550 IHWERDGQTL---PINRRQRAYNNGTLIIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPP 611

Human   235 GLHRQLYFLQRPSNVVAIEGKDAVLEC-CVSGYPPPSFTWLR--------GEEVIQLRSKKYSLL 290
                ::..:|..:|::. ||..|.:.| .:.|..|.||.|.|        |.||.: |..:||  
  Fly   612 ----KIMPIQAMTNMLR-EGMRAAISCQILEGDLPVSFRWERNGKPLIGTGNEVFR-RLDEYS-- 668

Human   291 GGSNLLISNVTDDDSGMYTCVVTYKNENISA----SAELTVLVPPWFLNHPSNLYAYESMDIEFE 351
              ::|:|.:::.|.||.|||:.:    |::.    :..|||.|||.::..|.:..|....|:...
  Fly   669 --ASLVIEHISSDHSGNYTCIAS----NVAGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLLH 727

Human   352 CTVSGKPVPTVNWMK----------------------NGDVV----------------------- 371
            |..||.|.||:.|.|                      ||.:.                       
  Fly   728 CQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKISKESQGHFLCEAKNNIGSG 792

Human   372 ----------IPSDYFQI------------------VGGSN------------------------ 384
                      :|: :||.                  |.|.|                        
  Fly   793 VSKVIFLKVNVPA-HFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQATQQYLDESLDSRYT 856

Human   385 -------------LRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKPAIPSSSVLPSAPRDVV 436
                         |.|....:.|.|.|.|.|.|..|..:.|.||||.:        :|..|:::.
  Fly   857 IRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQE--------VPEQPKNLR 913

Human   437 PVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTTQPGS-LQLTVGNLKPEAMYTF 500
            .....||.::|:|..|......|:.:.:::.:..|..:.|.:.|..|: ..:.:..|:|...|..
  Fly   914 INSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQISDIWQNAEHLTIAGAQTVINIQQLRPAKAYHI 978

Human   501 RVVAYNEWGPGESSQPIKVATQPELQVP-GPVENLQAVSTSPTSILITWEPPA--YANGPVQGYR 562
            |:.|.|:.|..|.|:.::|.|..|  || ||...::|...|.|.|.:||:.|.  :.||.:.||.
  Fly   979 RMSAENKLGASEFSEVVQVTTLEE--VPSGPPLAVRAEPKSSTEIFVTWDAPERDHWNGILLGYY 1041

Human   563 LFCTEVSTGKEQNIE-VDGLSYK-------------LEGLKKFTEYSLRFLAYNRYGPGVSTDDI 613
            :......|.:::.:. ..|.|:|             |..|.|||:|.:...||...|.|..:.:|
  Fly  1042 VGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNKFTQYHVIVQAYTSQGSGPPSKEI 1106

Human   614 TVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTRRGEM--ETLEP 676
            .|.|:.||||:||::...:|:.|.||.::|.||....|||.|.|||:.:.......|.  |.::.
  Fly  1107 AVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKS 1171

Human   677 NNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDLDESQVPDQPSSLHVRPQTNC- 740
            .|.:.....|.|.:.|:..|.|.|..|.|..:..:...|.|:      ||..|.::...|.::. 
  Fly  1172 TNQYVTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRTHED------VPSAPQAIKAIPASSSK 1230

Human   741 IIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQR--------YYSIERLESSSHYVISLK 797
            ||:||.||..||    |.|.||.......|..|.:...:        .:...|.:.|:.|...|.
  Fly  1231 IIISWLPPDLPN----GDITGYTFYMSMLEGGREEGTHKRLLGPFVEMHETVRTQESATYQFWLT 1291

Human   798 AFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDLSTPMLPP-----------VGVQ 851
            |....|||      ..|:.:|.|.:        :..|..:...|..::.|           ||..
  Fly  1292 ASTKMGEG------EKTQVVTVPPN--------NKVPARIVSFSQRIVTPWKEHLELPCRKVGAP 1342

Human   852 AVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSEDTTSLSYTATGLKPNTMY 916
            |..       ..|..:.  .|.:|| .|....:..|.:....:.......:.|...|..|...:|
  Fly  1343 APV-------TIWRQDG--HNMETS-ARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIVY 1397

Human   917 EFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVIVSWQPPLEANGKITAYI 981
            ...|.|                     |..|| :||||  .....::::.|.........|..|:
  Fly  1398 NIVVKV---------------------PPEAP-NLTVI--NAYTDSLLLEWMDNSHGGSPILGYV 1438

Human   982 LFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYFRIQARNSKGVGPLSDPILFRT----- 1041
            :.|..|..    ||....:.....:|.:.:|...|.|...|.|.|..|.|...|.:...|     
  Fly  1439 INYKRDNG----DWEELQVDSKTTSHLLTNLWCGTRYQLYITAYNKIGTGLPCDIVNSYTKGNPP 1499

Human  1042 LKVEHPDKMANDQ-------GRHGDGG----YWPVDTNLIDRSTL-----NEPPIGQM------- 1083
            ::.:|...:.|:.       ...||||    |:.:::.:..||:.     :.||..::       
  Fly  1500 VQPKHSQMITNNSTSVTCWLDSWGDGGCGILYFMIESRVYGRSSWAVVSNHIPPTERIYTVSDLV 1564

Human  1084 -----------HPPHGSVTPQKN----------------------------SNLLVIIVVTVGVI 1109
                       |...||.|...|                            :|..:::.:...::
  Fly  1565 PGTKYQLKVTAHNNAGSTTAIYNFTTLSTQGVIYNNDHSTPVSHLSDLPFYANFKLLLPICFSLL 1629

Human  1110 TVLVVVIVAVICTRRSSAQQRKKRATH-------------------------------------- 1136
            .:|.::..|:...:|..|.|.:..::.                                      
  Fly  1630 MLLALIGAALFLRKRKLASQARLASSSMSESPSLANLQNKQNRDQQYLAVRCNPGTSAPRGSNSN 1694

Human  1137 ---SAGKRKGSQ--KDLRPPDLWIHHEEMEMKNIEKPSGTDPAGR--DSPIQSCQ------DLTP 1188
               |.||.:|::  :|:.|      :...:: |.:..|.:..:|.  ..|..|.:      |:.|
  Fly  1695 DSGSFGKAEGNEYIEDICP------YATFQL-NKQTYSESSYSGNVYSGPYHSVRGSFVYHDVKP 1752

Human  1189 VSHSQSETQ-------LGSKSTSHS-GQDTEEAGSSMSTLERSLAARRAPRAKLMIP------MD 1239
            .|:...|.:       :|.....|| .|:::..||:.|.:.:.|.        |.||      :.
  Fly  1753 ESYHSKEPEYTKVRRKVGRLRDPHSESQESDNPGSTDSEVRKILT--------LHIPITEYDTLG 1809

Human  1240 AQSNNPAVVSAIPVPTLESAQYPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRSQSVSEG 1304
            ::|:|.....|     |.||:|                                   |:|.    
  Fly  1810 SESDNDVSARA-----LNSAKY-----------------------------------RAQR---- 1830

Human  1305 PTTQQPPMLPPSQPEHSSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQ 1369
                      .:|.|.|||.|    |.||:..|.:           .||.:|.:.        .:
  Fly  1831 ----------DTQDETSSSSE----TTPTSMTRKS-----------KPPFAARKG--------GK 1862

Human  1370 PGPTLPKTHVKTASLGLAGKARSPLLPVS-VPTAPEVSEESHKPTEDS-ANVYEQDDLSEQMASL 1432
            || |..|.||:::| |.:.........:| .|  |...:..:.|...| ||...:...|.:|.:.
  Fly  1863 PG-TSGKRHVRSSS-GYSSHNEETTFSISNYP--PNYQDHINPPARFSDANDKTKTQTSPRMRAN 1923

Human  1433 EGLMKQ 1438
            :.|.::
  Fly  1924 QKLHRE 1929

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCCNP_005206.2 IgI_1_Neogenin_like 39..136 CDD:409387 24/94 (26%)
Ig strand A 39..42 CDD:409387
Ig strand A' 45..51 CDD:409387 1/3 (33%)
Ig strand B 55..65 CDD:409387 4/9 (44%)
Ig strand C 70..76 CDD:409387 2/5 (40%)
Ig strand C' 78..81 CDD:409387 1/2 (50%)
Ig strand D 88..93 CDD:409387 1/8 (13%)
Ig strand E 95..101 CDD:409387 1/5 (20%)
Ig strand F 113..120 CDD:409387 4/8 (50%)
Ig strand G 125..136 CDD:409387 4/10 (40%)
Ig_3 139..216 CDD:464046 25/77 (32%)
I-set 241..327 CDD:400151 28/98 (29%)
Ig strand B 257..261 CDD:409562 1/3 (33%)
Ig strand C 270..274 CDD:409562 2/3 (67%)
Ig strand E 293..297 CDD:409562 1/3 (33%)
Ig strand F 307..312 CDD:409562 3/4 (75%)
Ig strand G 322..325 CDD:409562 0/2 (0%)
Ig 334..417 CDD:472250 31/192 (16%)
Ig strand B 348..352 CDD:409388 0/3 (0%)
Ig strand C 361..365 CDD:409388 1/3 (33%)
Ig strand E 383..387 CDD:409388 2/40 (5%)
Ig strand F 397..402 CDD:409388 2/4 (50%)
Ig strand G 410..413 CDD:409388 0/2 (0%)
FN3 429..521 CDD:238020 22/92 (24%)
FN3 <478..901 CDD:442628 120/462 (26%)
FN3 946..1041 CDD:238020 23/94 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1126..1152 8/68 (12%)
Neogenin_C 1148..1445 CDD:461954 61/315 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1165..1222 15/72 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1288..1330 8/41 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1394..1419 6/26 (23%)
Interaction with MYO10. /evidence=ECO:0000269|PubMed:21642953 1432..1439 1/7 (14%)
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549
Ig strand A 330..335 CDD:409549
Ig strand A' 338..342 CDD:409549
Ig strand B 345..355 CDD:409549
Ig strand C 360..366 CDD:409549
Ig strand C' 367..370 CDD:409549
Ig strand E 383..389 CDD:409549
Ig strand F 396..404 CDD:409549
Ig strand G 407..417 CDD:409549
IgI_4_Dscam 422..516 CDD:409548 24/94 (26%)
Ig strand A' 430..434 CDD:409548 0/3 (0%)
Ig strand B 437..446 CDD:409548 4/9 (44%)
Ig strand C 451..457 CDD:409548 2/5 (40%)
Ig strand C' 459..462 CDD:409548 1/2 (50%)
Ig strand D 467..475 CDD:409548 1/7 (14%)
Ig strand E 479..488 CDD:409548 1/8 (13%)
Ig strand F 495..503 CDD:409548 4/7 (57%)
Ig strand G 506..516 CDD:409548 5/13 (38%)
IgI_5_Dscam 520..607 CDD:409550 26/89 (29%)
Ig strand A 520..522 CDD:409550 0/1 (0%)
Ig strand A' 527..531 CDD:409550 1/3 (33%)
Ig strand B 534..541 CDD:409550 1/6 (17%)
Ig strand C 548..554 CDD:409550 3/5 (60%)
Ig strand C' 555..557 CDD:409550 0/1 (0%)
Ig strand D 564..568 CDD:409550 1/3 (33%)
Ig strand E 571..577 CDD:409550 3/5 (60%)
Ig strand F 585..593 CDD:409550 4/7 (57%)
Ig strand G 597..607 CDD:409550 1/9 (11%)
Ig 610..703 CDD:472250 29/106 (27%)
Ig strand B 629..633 CDD:409353 1/3 (33%)
Ig strand C 643..647 CDD:409353 2/3 (67%)
Ig strand E 669..673 CDD:409353 1/3 (33%)
Ig strand F 683..688 CDD:409353 3/4 (75%)
Ig strand G 696..699 CDD:409353 0/2 (0%)
IgI_7_Dscam 706..801 CDD:409546 15/94 (16%)
Ig strand A 706..710 CDD:409546 2/3 (67%)
Ig strand A' 715..719 CDD:409546 0/3 (0%)
Ig strand B 722..731 CDD:409546 2/8 (25%)
Ig strand C 737..743 CDD:409546 2/5 (40%)
Ig strand C' 749..752 CDD:409546 0/2 (0%)
Ig strand D 760..763 CDD:409546 0/2 (0%)
Ig strand E 766..772 CDD:409546 1/5 (20%)
Ig strand F 779..787 CDD:409546 0/7 (0%)
Ig strand G 792..801 CDD:409546 0/8 (0%)
Ig 804..889 CDD:472250 13/85 (15%)
Ig strand B 822..826 CDD:409353 0/3 (0%)
Ig strand C 835..839 CDD:409353 0/3 (0%)
FN3 <850..1254 CDD:442628 119/423 (28%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 906..999 CDD:238020 22/92 (24%)
fn3 1117..1203 CDD:394996 27/85 (32%)
FN3 1185..>1580 CDD:442628 92/456 (20%)
FN3 1405..1494 CDD:238020 23/95 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.