Sequence 1: | NP_001071092.1 | Gene: | ZNF846 / 162993 | HGNCID: | 27260 | Length: | 533 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_851304.2 | Gene: | sp5a / 353154 | ZFINID: | ZDB-GENE-030430-2 | Length: | 368 | Species: | Danio rerio |
Alignment Length: | 133 | Identity: | 51/133 - (38%) |
---|---|---|---|
Similarity: | 70/133 - (52%) | Gaps: | 28/133 - (21%) |
- Green bases have known domain annotations that are detailed below.
Human 192 HTQEKL--------CECKDCWRTFLNQSSLKLHIRSHNGD----KHYVC--KECGKAFSNSSHLI 242
Human 243 GHGRIHSGEKPYVCK--ECGKAFTQSTGLKLHIRTHSGEKPYKCKECGKAFTHSSYLTDHTRIHS 305
Human 306 GKK 308 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
NCBI | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |