DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ZNF846 and sp5a

DIOPT Version :9

Sequence 1:	NP_001071092.1	Gene:	ZNF846 / 162993	HGNCID:	27260	Length:	533	Species:	Homo sapiens
Sequence 2:	NP_851304.2	Gene:	sp5a / 353154	ZFINID:	ZDB-GENE-030430-2	Length:	368	Species:	Danio rerio

Alignment Length:	133	Identity:	51/133 - (38%)
Similarity:	70/133 - (52%)	Gaps:	28/133 - (21%)

- Green bases have known domain annotations that are detailed below.

Human   192 HTQEKL--------CECKDCWRTFLNQSSLKLHIRSHNGD----KHYVC--KECGKAFSNSSHLI 242
            ||:..|        |.|.:|      |||      |.:.:    |.::|  ..|||.:..:|||.
Zfish   229 HTKSPLATARRCRRCRCPNC------QSS------SSSDEPGKKKQHICHIPGCGKVYGKTSHLK 281

Human   243 GHGRIHSGEKPYVCK--ECGKAFTQSTGLKLHIRTHSGEKPYKCKECGKAFTHSSYLTDHTRIHS 305
            .|.|.||||:|:||.  .|||:||:|..|:.|:|||:|||.:.|.:|.|.|..|.:|..|.:.|.
Zfish   282 AHLRWHSGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFVCPDCCKRFMRSDHLAKHVKTHQ 346

Human   306 GKK 308
            .||
Zfish   347 NKK 349

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ZNF846	NP_001071092.1	KRAB	8..67	CDD:214630
		KRAB	8..45	CDD:279668
		COG5048	106..496	CDD:227381	51/133 (38%)
		C2H2 Zn finger	120..136	CDD:275368
		C2H2 Zn finger	200..220	CDD:275368	5/19 (26%)
		C2H2 Zn finger	228..248	CDD:275368	9/21 (43%)
		C2H2 Zn finger	256..276	CDD:275368	10/21 (48%)
		zf-H2C2_2	269..293	CDD:290200	12/23 (52%)
		C2H2 Zn finger	284..304	CDD:275368	7/19 (37%)
		zf-H2C2_2	296..321	CDD:290200	5/13 (38%)
		C2H2 Zn finger	312..332	CDD:275368
		zf-H2C2_2	328..347	CDD:290200
		zf-C2H2	338..360	CDD:278523
		C2H2 Zn finger	340..360	CDD:275368
		zf-H2C2_2	352..377	CDD:290200
		C2H2 Zn finger	368..388	CDD:275368
		zf-H2C2_2	381..405	CDD:290200
		C2H2 Zn finger	396..416	CDD:275368
		zf-H2C2_2	408..433	CDD:290200
		C2H2 Zn finger	424..444	CDD:275368
		zf-H2C2_2	437..461	CDD:290200
		C2H2 Zn finger	452..472	CDD:275368
		zf-H2C2_2	464..489	CDD:290200
		C2H2 Zn finger	480..500	CDD:275368
		zf-H2C2_2	492..517	CDD:290200
		C2H2 Zn finger	508..527	CDD:275368
sp5a	NP_851304.2	C2H2 Zn finger	268..287	CDD:275368	8/18 (44%)
		zf-H2C2_2	279..306	CDD:290200	15/26 (58%)
		C2H2 Zn finger	295..317	CDD:275368	10/21 (48%)
		zf-H2C2_2	309..332	CDD:290200	11/22 (50%)
		C2H2 Zn finger	325..345	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
NCBI	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.910