DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Il1r2 and CG45263

DIOPT Version :9

Sequence 1:NP_001347729.1 Gene:Il1r2 / 16178 MGIID:96546 Length:428 Species:Mus musculus
Sequence 2:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster


Alignment Length:406 Identity:96/406 - (23%)
Similarity:152/406 - (37%) Gaps:112/406 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    66 EFKSELRLEGEP----------VVLRCPLAPHSDISSSSHSFLTWSKLDSSQLIPRDEPRMWVKG 120
            ::...:||.|.|          :||||....:...|      :.|.:...|::....|       
  Fly   282 KYAPSIRLIGSPEIDLEEDKDALVLRCVADANPPAS------IVWRRAGRSEIASLQE------- 333

Mouse   121 NILWILPAVQQDSGTYICTFRNA-SHCEQMSVELKVFKNTEASLPHVSYLQISA---LSTTGLLV 181
             .|.:.|..::|:|.|.|..:|: ...||:||:|.|     ...|.:    |||   ..||..|.
  Fly   334 -TLQLRPVGRRDAGLYTCQAQNSVGTSEQLSVQLDV-----KYPPKI----ISAGPDRLTTAPLF 388

Mouse   182 CPDLKEFISSNADGK-IQWYKGAILLDKGNKEFLSAGDPTRLLISNTSMDDAGYYRCVMTFTYNG 245
            .|...|.:   |||. :..:|....:..|:| ::..|..:||:|.|.:.:..|.|.|..|...||
  Fly   389 SPAAFECL---ADGNPLPSFKWVQRMAHGSK-YVERGSESRLVIDNVTYEYQGEYECRATSYING 449

Mouse   246 QE-YNITRNIELRVKGTTTEPIPVIISP-LETIPASLG---SRLIVPCKVFLGTGTSSNTIVW-W 304
            || ..|:..:.|:|.|.   |..:.:.| |.|:....|   |..:|.|     .......:.| |
  Fly   450 QERVAISDPVSLQVVGA---PQVLRLHPSLHTVSVKRGEAASLTMVVC-----ADPRPQRVAWEW 506

Mouse   305 LANSTFISAAYPRGRVTEGLHHQYSENDENYVEVSLIFDPVTRED--------LHTD------FK 355
            .:......:...|.|..:                   ..|.||||        ||.|      :.
  Fly   507 GSLRLEAGSGIDRFRADD-------------------MQPDTREDCYLSTLHILHADEHDSRPYY 552

Mouse   356 CVASNPRSS--QSLHTTVKEVSSTF------SWSIALAP------LSLIILVVGAIWMRRRCKRR 406
            .|..|.|.:  .::|..|:   .||      |:.:.:|.      |.|:.|.:.||..:|.|.: 
  Fly   553 LVVENERGTDRHAIHLIVE---GTFAEPYEMSYLMGVAGGCMAAILLLVCLCIYAIKSKRCCFK- 613

Mouse   407 AGKTYGLTKLRTDNQD 422
                 |.|..::.::|
  Fly   614 -----GSTGYKSSDKD 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Il1r2NP_001347729.1 PHA02785 54..382 CDD:165149 85/358 (24%)
CG45263NP_731246.2 I-set 53..149 CDD:254352
Ig 198..281 CDD:299845
IG_like 302..368 CDD:214653 20/79 (25%)
IGc2 302..357 CDD:197706 15/68 (22%)
Ig 372..446 CDD:299845 24/81 (30%)
Ig 475..568 CDD:299845 21/116 (18%)
IG_like 478..570 CDD:214653 21/115 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.