DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAZ1 and tcg1

DIOPT Version :9

Sequence 1:NP_004072.3 Gene:DAZ1 / 1617 HGNCID:2682 Length:744 Species:Homo sapiens
Sequence 2:NP_595090.2 Gene:tcg1 / 2541062 PomBaseID:SPBC660.11 Length:349 Species:Schizosaccharomyces pombe


Alignment Length:314 Identity:69/314 - (21%)
Similarity:120/314 - (38%) Gaps:76/314 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   155 QITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDET 219
            |..||.|...|:::.:...       .||.:.|:..|.|.        ....||||.:.....::
pombe    10 QNAPNTVQDQVEASVDAAV-------HASAEQSNTPAQQA--------DDFRVFVGRLSTSTKKS 59

Human   220 EIGSCFGRYGSVKEVKIITNRTG-----VSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAI 279
            ||.|.|...|:|::|.|...|..     |..|..||:|.|..||.|.:.:   .:||.|      
pombe    60 EIRSLFETVGTVRKVTIPFRRVRRGTRLVPSGIAFVTFNNQEDVDKAIET---LNGKTL------ 115

Human   280 RKQKLCARHVQPRPLVVNPPPPPQFQNV-----WRNPNTETYLQPQITPNPVTQHVQSAANPETP 339
                      ..|.:||....|.|.|.:     .:|.|.|   :|:.:.:.........::.|..
pombe   116 ----------DDREIVVQKARPVQEQPIKDRKKSKNKNGE---EPETSTSVENAESAKGSSDENE 167

Human   340 NSTISREASTQSSSAAASQGWVLPEG--------KIVPNTVFVGGIDARMDETEIGSCFGRYGS- 395
            .:|.:..:|.:::.....|..:..:|        .:.||:::|.|:...:....:...|..|.. 
pombe   168 ANTATAPSSNEANGVDKKQNEIKGKGGSGKNKAKPLPPNSIYVSGLSVTLTNEGLKEMFDAYNPT 232

Human   396 -------------VKEVKII-TNRTGVSKGYGFVSFVNDVD----VQKIVGSQI 431
                         ::.:|:. ..|.|  :|:|||||.|..|    ::::.|.|:
pombe   233 RARIAVRSLPPYIIRRIKLRGEQRRG--RGFGFVSFANAEDQSRAIEEMNGKQV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAZ1NP_004072.3 RRM_DAZL 35..116 CDD:241116
PABP-1234 42..603 CDD:130689 69/314 (22%)
RRM_DAZL 200..281 CDD:241116 25/85 (29%)
RRM_DAZL 365..446 CDD:241116 20/94 (21%)
tcg1NP_595090.2 RRM_SF 46..124 CDD:302621 28/96 (29%)
RRM 207..291 CDD:214636 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.