DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAPK3 and CaMKI

DIOPT Version :9

Sequence 1:NP_001339.1 Gene:DAPK3 / 1613 HGNCID:2676 Length:454 Species:Homo sapiens
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:381 Identity:123/381 - (32%)
Similarity:191/381 - (50%) Gaps:47/381 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     5 RQEDVEDHYEMGEELGSGQFAIVRKCRQKGT-GKEYAAKFIKKRRLSSSRRGVSREEIEREVNIL 68
            :|..:|:.|.:...||:|.|:.||....|.: |:.:|.|.|.|:.|..     ..|.:|.|:.:|
  Fly    23 KQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKG-----KEESLENEIRVL 82

Human    69 R---------------EIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQ 118
            |               .:.||||:.|.:.:|:|:.|.|::|||:||||||.:.||.|.||.:|:.
  Fly    83 RRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASH 147

Human   119 FLKQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEF 183
            .::|||:.|.|:|.:.:.|.||||||::....: .:.:|.:.|||:: |:|.........|||.:
  Fly   148 LIRQILEAVDYMHEQGVVHRDLKPENLLYYSPD-DDSKIMISDFGLS-KMEDSGIMATACGTPGY 210

Human   184 VAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELA 248
            ||||::..:|.|...|:||||||:||||.|..||..|........|...:::||..|:...||.|
  Fly   211 VAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESA 275

Human   249 KDFIRRLLVKDPKRRMTIAQSLEHSWIKA--IRRRNVRG---EDSGRKPERRRLKTTRLKEYTIK 308
            |.||:.|:....::|.|..|:|.|:||..  ...||:.|   |...:...:.|.|........|:
  Fly   276 KHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIR 340

Human   309 SHSSLPPN-NSYADFER------------------FSKVLEEAAAAEEGLRELQRS 345
            ....:..| ||.|:|:.                  .|.||....:.:...:|:.:|
  Fly   341 QMQRMALNSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSVQSHAQEMNKS 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAPK3NP_001339.1 STKc_DAPK 7..275 CDD:271007 103/283 (36%)
Activation segment. /evidence=ECO:0000250|UniProtKB:O96017 161..204 17/42 (40%)
Leucine-zipper. /evidence=ECO:0000303|PubMed:9488481 427..441
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 103/280 (37%)
S_TKc 31..302 CDD:214567 102/277 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.