DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAPK3 and CG10126

DIOPT Version :9

Sequence 1:NP_001339.1 Gene:DAPK3 / 1613 HGNCID:2676 Length:454 Species:Homo sapiens
Sequence 2:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster


Alignment Length:158 Identity:32/158 - (20%)
Similarity:60/158 - (37%) Gaps:56/158 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   326 SKVLEEAAAAEE---GLRELQRSRRLCHEDVEALAAIYEE------------------------- 362
            ||.|.|    ||   |:|:  ....:..|:::.:.|.::|                         
  Fly    74 SKALNE----EEFITGIRD--TGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLN 132

Human   363 --KEAWYREESDSLG----QDLRRLRQELLKTEALKRQAQEEAKGALL---------GTSGLKRR 412
              .:|:.:.:.|..|    |||:.:..   ..|..|.|:.|:::..:|         |...|..:
  Fly   133 IIDQAFNKMDRDEDGVITIQDLKNVYS---VKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGK 194

Human   413 FSRLE--NRYEALAKQVASEMRFVQDLV 438
            .:|.|  |.|..::..:.::|.|  ||:
  Fly   195 ITREEFVNYYATISASIDNDMFF--DLM 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAPK3NP_001339.1 STKc_DAPK 7..275 CDD:271007
Activation segment. /evidence=ECO:0000250|UniProtKB:O96017 161..204
Leucine-zipper. /evidence=ECO:0000303|PubMed:9488481 427..441 4/12 (33%)
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 11/50 (22%)
EFh 64..119 CDD:238008 11/50 (22%)
EFh 97..154 CDD:238008 6/56 (11%)
EF-hand_7 98..158 CDD:290234 8/59 (14%)
EF-hand_7 134..204 CDD:290234 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.